Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate 3609453 Dshi_2837 aminotransferase class IV (RefSeq)
Query= CharProtDB::CH_024500 (309 letters) >FitnessBrowser__Dino:3609453 Length = 286 Score = 104 bits (260), Expect = 2e-27 Identities = 86/280 (30%), Positives = 135/280 (48%), Gaps = 19/280 (6%) Query: 17 RWEDAKVHVMSHALH---YGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVS 73 RW D V +M A H G++VF+G R D + H R++ SA+ + Sbjct: 14 RWHDGDVPIMRAADHGSWLGSTVFDGARWVDGVAPDLA----AHCARVNASAEALMITPT 69 Query: 74 QSIDELMEACRDVIRKNNLTSA-YIRPLIFVGDVGMGVNPPAGYSTD--VIIAAFPWGAY 130 + +E++E + ++ +A YIRP+ + D G P +T + + P Sbjct: 70 VTTEEMVEIALEGVKSYPPEAAVYIRPMYWALDGGHLAIVPRENATGFALCLEEIPMAPP 129 Query: 131 LGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNG 190 A L + + + R T AKAG Y ++ + +EAR G+ + D G Sbjct: 130 DTATTLTR------TRFRRPVLEDNLTNAKAGCLYPNNARMLAEARAKGFGNALVADAMG 183 Query: 191 YISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLA 250 ++E A NLF V+DGV+ TP + L GITR I + G+EVRE VLS E + A Sbjct: 184 NVAESATSNLFIVRDGVVLTPIPNGTFLAGITRARHIANLRADGVEVRETVLSFEDVAEA 243 Query: 251 DEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFF 290 DEVF+SG ++TPV + D Q + GP+T+R + ++ Sbjct: 244 DEVFLSGNMMKVTPVTAFDDRQY---QIGPLTRRARALYW 280 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 286 Length adjustment: 26 Effective length of query: 283 Effective length of database: 260 Effective search space: 73580 Effective search space used: 73580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory