GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvH in Dinoroseobacter shibae DFL-12

Align acetohydroxyacid synthase subunit B (EC 2.2.1.6) (characterized)
to candidate 3608378 Dshi_1779 acetolactate synthase, large subunit, biosynthetic type (RefSeq)

Query= metacyc::MONOMER-18810
         (585 letters)



>FitnessBrowser__Dino:3608378
          Length = 585

 Score =  609 bits (1571), Expect = e-179
 Identities = 310/571 (54%), Positives = 400/571 (70%), Gaps = 6/571 (1%)

Query: 18  EMIGAEILVHALAEEGVEYVWGYPGGAVLYIYDELHKQTKFEHILVRHEQAAVHAADGYA 77
           +M GA+++V AL ++GV+ V+GYPGGAVL IYDE+ +Q + +HILVRHEQAA HAA+GYA
Sbjct: 4   QMTGAQMVVQALKDQGVDTVFGYPGGAVLPIYDEIFQQNEIKHILVRHEQAATHAAEGYA 63

Query: 78  RATGKVGVALVTSGPGVTNAVTGIATAYLDSIPMVVITGNVPTHAIGQDAFQECDTVGIT 137
           R+TGK GV LVTSGPG TNAVTGI  A +DSIPMVV++G VPT  IG DAFQE DTVGIT
Sbjct: 64  RSTGKPGVVLVTSGPGATNAVTGITDALMDSIPMVVLSGQVPTFMIGNDAFQEADTVGIT 123

Query: 138 RPIVKHNFLVKDVRDLAATIKKAFFIAATGRPGPVVVDIPKDVSRNACKYEYPKSIDMRS 197
           RP  KHN+LVK+   LA TI +AF +A +GRPGPV+VDIPKDV   +  Y  P   D R 
Sbjct: 124 RPCTKHNWLVKETDLLADTIHQAFHVATSGRPGPVLVDIPKDVQFASGTYVPPAKADTRH 183

Query: 198 YNPVNKGHSGQIRKAVALLQGAERPYIYTGGGVVLAN--ASDELRQLAALTGHPVTNTLM 255
           Y P  KG    I   V L++ AERP  YTGGGV+ +   AS  LR+  A TG P+T+TLM
Sbjct: 184 YQPRVKGDVAAITAMVELMETAERPIFYTGGGVINSGPAASQLLREFVAETGFPITSTLM 243

Query: 256 GLGAFPGTSKQFVGMLGMHGTYEANMAMQNCDVLIAIGARFDDRVIGNPAHFTSQARKII 315
           GLGA+P + + ++GMLGMHG YEAN+AM  CDV+I IGARFDDR+ G  A F+ +++K I
Sbjct: 244 GLGAYPASGENWIGMLGMHGLYEANLAMHGCDVMINIGARFDDRITGRVADFSPESKK-I 302

Query: 316 HIDIDPSSISKRVKVDIPIVGNVKDVLQELIAQIKASDIKPKREALAKWWEQIEQWRSVD 375
           HIDIDPSSI+K ++ D+PI+G++  VL++ +   KA   K  + A+  WW QIE+WR+V 
Sbjct: 303 HIDIDPSSINKVIRTDVPIIGDIAHVLEDALRIWKARGRKTNKAAVKAWWTQIEEWRTVR 362

Query: 376 CLKYDRSSEIIKPQYVVEKIWELTKG--DAFICSDVGQHQMWAAQFYKFDEPRRWINSGG 433
           CL +  S   IKPQY ++++  LTK     FI ++VGQHQMWAAQ+  FDEP RW+ SGG
Sbjct: 363 CLDFKNSETTIKPQYAMQRLEALTKDHPKRFIATEVGQHQMWAAQYLGFDEPNRWMTSGG 422

Query: 434 LGTMGVGLPYAMGIKKAFPEKEVVTITGEGSIQMCIQELSTCLQYDTPVKICSLNNGYLG 493
           LGTMG G P ++G++ A P+  V+ + GE S  M +QE+ T +QY  PVK   LNN  LG
Sbjct: 423 LGTMGYGFPASIGVQVAHPDALVINVAGEASWLMNMQEMGTAIQYMLPVKQFILNNERLG 482

Query: 494 MVRQWQEIEYDNRYSHSYMDALPDFVKLAEAYGHVGMRVEKTSDVEPALREAFRLKDRTV 553
           MVRQWQE+ +  RYSHS+ DALPDFVKLAEA+G  G+  +   D++ A+ E     D  V
Sbjct: 483 MVRQWQELLHGERYSHSWSDALPDFVKLAEAFGAKGILCKDPKDLDDAIMEMLEY-DGPV 541

Query: 554 FLDFQTDPTENVWPMVQAGKGISEMLLGAED 584
             D   +  EN +PM+ +G   +EMLLG  D
Sbjct: 542 IFDCLVEKHENCFPMIPSGAPHNEMLLGEAD 572


Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 952
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 585
Length of database: 585
Length adjustment: 37
Effective length of query: 548
Effective length of database: 548
Effective search space:   300304
Effective search space used:   300304
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

Align candidate 3608378 Dshi_1779 (acetolactate synthase, large subunit, biosynthetic type (RefSeq))
to HMM TIGR00118 (ilvB: acetolactate synthase, large subunit, biosynthetic type (EC 2.2.1.6))

Software error:

../bin/blast/fastacmd -i /tmp/list.22054.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.22054.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.