Align 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 (characterized)
to candidate 3606652 Dshi_0083 3-isopropylmalate dehydratase, small subunit (RefSeq)
Query= SwissProt::Q1MA52 (202 letters) >FitnessBrowser__Dino:3606652 Length = 201 Score = 321 bits (823), Expect = 5e-93 Identities = 148/200 (74%), Positives = 176/200 (88%) Query: 1 MDKFVKLTGVAAPLPVVNVDTDMIIPKDYLKTIKRTGLGTGLFAEARYNEDGSENPDFVL 60 M+KF KLTG+AAP+P+VN+DTDMIIPK +LKTIKR+GLG LF E RY+ G+ENPDFVL Sbjct: 1 MEKFTKLTGIAAPMPLVNIDTDMIIPKQFLKTIKRSGLGVNLFDEMRYDRQGNENPDFVL 60 Query: 61 NKPAYRDAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFYNNCFKNGILPIK 120 NKP YRDA+ILV G+NFGCGSSREHAPWALLDFGIRCVI+ SFADIFYNNCFKNGILPI Sbjct: 61 NKPQYRDAQILVTGENFGCGSSREHAPWALLDFGIRCVIAPSFADIFYNNCFKNGILPIA 120 Query: 121 VSQEDLDKLMDDASRGSNAILTVDLENLEITGPDGGLIKFDLDEFKRHCLLNGLDDIGLT 180 + QE++DKLMDDA+RG+NA +TVDLEN I+GPDGG I F++D FK+HCLLNGLDDIGL+ Sbjct: 121 LPQEEVDKLMDDAARGANATVTVDLENQTISGPDGGTISFEVDAFKKHCLLNGLDDIGLS 180 Query: 181 LEKGKAIDSFEKKNAASHPW 200 LEK +ID+FE + +A+ PW Sbjct: 181 LEKVASIDAFEAQASAARPW 200 Lambda K H 0.319 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 202 Length of database: 201 Length adjustment: 21 Effective length of query: 181 Effective length of database: 180 Effective search space: 32580 Effective search space used: 32580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate 3606652 Dshi_0083 (3-isopropylmalate dehydratase, small subunit (RefSeq))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.14614.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-84 267.1 0.0 4.9e-84 266.9 0.0 1.0 1 lcl|FitnessBrowser__Dino:3606652 Dshi_0083 3-isopropylmalate dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3606652 Dshi_0083 3-isopropylmalate dehydratase, small subunit (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 266.9 0.0 4.9e-84 4.9e-84 1 184 [. 1 183 [. 1 187 [. 0.97 Alignments for each domain: == domain 1 score: 266.9 bits; conditional E-value: 4.9e-84 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryldekGkepnpefvlnvpqyqgasillare 77 m++f kltG+++p+ +n+dtd iipkqflk+ikr G+g +lf e ry d +G ++np+fvln pqy++a+il+++e lcl|FitnessBrowser__Dino:3606652 1 MEKFTKLTGIAAPMPLVNIDTDMIIPKQFLKTIKRSGLGVNLFDEMRY-DRQG-NENPDFVLNKPQYRDAQILVTGE 75 899*********************************************.****.89********************* PP TIGR00171 78 nfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkltvdleaqkvkd 153 nfGcGssrehapwal d+G++ +iapsfadifynn+fkng+lpi l++eev++l+ + +tvdle+q++ lcl|FitnessBrowser__Dino:3606652 76 NFGCGSSREHAPWALLDFGIRCVIAPSFADIFYNNCFKNGILPIALPQEEVDKLMDDAArGANATVTVDLENQTISG 152 *******************************************************9988688899************ PP TIGR00171 154 segkvysfeidefrkhcllnGldeigltlqk 184 +g ++sfe+d+f+khcllnGld+igl+l k lcl|FitnessBrowser__Dino:3606652 153 PDGGTISFEVDAFKKHCLLNGLDDIGLSLEK 183 ****************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (201 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.04 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory