GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapD in Dinoroseobacter shibae DFL-12

Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate 3606574 Dshi_0006 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (RefSeq)

Query= SwissProt::P56220
         (274 letters)



>lcl|FitnessBrowser__Dino:3606574 Dshi_0006
           2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase (RefSeq)
          Length = 275

 Score =  343 bits (879), Expect = 3e-99
 Identities = 177/272 (65%), Positives = 210/272 (77%), Gaps = 5/272 (1%)

Query: 3   QLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEK-IDGQWVTHQWLKK 61
           QL+  IE+A+E R  I+PA     TREA+ + +  LDSGALRVAE+  DG W  +QW KK
Sbjct: 5   QLETAIEAAWEARDTISPATTGE-TREAIEETLNALDSGALRVAERGADGSWHVNQWAKK 63

Query: 62  AVLLSFRINDNKVMDGAETR--YYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIAR 119
           AVLL FRI D +   G      ++DKV  KF  ++   ++K GFR VP   VR+ A+IA 
Sbjct: 64  AVLLGFRIKDMEAQSGGPQGGGWWDKVDSKFLGWNSGAWEKAGFRAVPSCVVRKSAYIAP 123

Query: 120 NTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179
             VLMPS+VN+GAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEP+QA PTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 180 DNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLP 239
           DNCFIGARSEVVEG IV EGSV+ MGV++GQST+I DRETGE+ YG VP  SVVV+G++P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 240 SKDGSYSLYCAVIVKKVDAKTRGKVGINELLR 271
           SK+G  +LYCAVIVK+VD +TR K GINELLR
Sbjct: 244 SKNG-VNLYCAVIVKRVDERTRSKTGINELLR 274


Lambda     K      H
   0.318    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 288
Number of extensions: 11
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 274
Length of database: 275
Length adjustment: 25
Effective length of query: 249
Effective length of database: 250
Effective search space:    62250
Effective search space used:    62250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate 3606574 Dshi_0006 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (RefSeq))
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00965.hmm
# target sequence database:        /tmp/gapView.9314.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00965  [M=271]
Accession:   TIGR00965
Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   5.6e-130  418.6   0.6   6.3e-130  418.5   0.6    1.0  1  lcl|FitnessBrowser__Dino:3606574  Dshi_0006 2,3,4,5-tetrahydropyri


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3606574  Dshi_0006 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (RefSe
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  418.5   0.6  6.3e-130  6.3e-130       2     269 ..       6     274 ..       5     275 .] 0.97

  Alignments for each domain:
  == domain 1  score: 418.5 bits;  conditional E-value: 6.3e-130
                         TIGR00965   2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekl.dgqwkvnewvkkavllsfritdnqvlndav 77 
                                       l   ie a+e r+ i pa+ + +++ea++e+++ ldsgalrvae+  dg w+vn+w+kkavll fri+d +   ++ 
  lcl|FitnessBrowser__Dino:3606574   6 LETAIEAAWEARDTISPAT-TGETREAIEETLNALDSGALRVAERGaDGSWHVNQWAKKAVLLGFRIKDMEAQSGGP 81 
                                       6789************987.5799*********************879*********************99999875 PP

                         TIGR00965  78 n..kyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtmvdtwatvgscaqigk 152
                                       +   ++dkv +kf  ++   +++ag+r+vp+ vvr+ a+ia  vvlmps+vn+gayvdegtmvdtwatvgscaqigk
  lcl|FitnessBrowser__Dino:3606574  82 QggGWWDKVDSKFLGWNSGAWEKAGFRAVPSCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGK 158
                                       4227************************************************************************* PP

                         TIGR00965 153 nvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvfigqstkivdretgeiiygrvpags 229
                                       nvhlsggvgiggvlep+qa p+iiedncfigarse+veg iv egsv+ mgvfigqstkivdretge++yg vp +s
  lcl|FitnessBrowser__Dino:3606574 159 NVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYS 235
                                       ***************************************************************************** PP

                         TIGR00965 230 vvvsgslpskdgkkslycavivkkvdaktrgkvsinellr 269
                                       vvv+gs+psk+g  +lycavivk+vd++tr+k++inellr
  lcl|FitnessBrowser__Dino:3606574 236 VVVAGSMPSKNGV-NLYCAVIVKRVDERTRSKTGINELLR 274
                                       ***********96.7************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (271 nodes)
Target sequences:                          1  (275 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 9.36
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory