Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate 3607379 Dshi_0793 O-acetylhomoserine/O-acetylserine sulfhydrylase (RefSeq)
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >FitnessBrowser__Dino:3607379 Length = 431 Score = 253 bits (645), Expect = 1e-71 Identities = 150/424 (35%), Positives = 234/424 (55%), Gaps = 14/424 (3%) Query: 2 NDKKTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGRQ 61 +D +YGF T +H+ + G+ PI+ + + + DA A +F ++ GY Y R Sbjct: 3 DDTPSYGFDTLQIHAGARPDPATGARQTPIYQTTGYVFRDADHAAALFNLQEVGYIYSRL 62 Query: 62 GNPTVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNT-NSLW 120 NPTVA L+++I +E G +C ++G AA + L++ G ++V S L+G T Sbjct: 63 TNPTVAVLQERIATLEGGVGAVCCSSGHAAQIMALFPLMQPGCNIVVSTRLYGGTVTQFG 122 Query: 121 MTVGAQGAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGIL 180 T+ G VD D+ V AAI +TR VF E IANP + D++ I ++ GI Sbjct: 123 QTIKRFGWSAKFVDFDDLDAVRAAIDDDTRAVFGEAIANPGGYIMDVRAIADIADAAGIP 182 Query: 181 YVVDNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDWT---RYPHIA 237 ++DNT +PYL RP GA LVV+S TK + G+G GG + D+G+FDW ++P ++ Sbjct: 183 LIIDNTTATPYLCRPIEHGATLVVHSTTKYLTGNGTVTGGCVVDSGKFDWAASGKFPSLS 242 Query: 238 E--------NYKKNPAPQWGMAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECK 289 E + + P A LRD G ++ P+ AH+ +G ET++LR R + Sbjct: 243 EPEPAYHGLRFAETFGPLAFTFHGIAVGLRDLGMTMNPQGAHYTLMGIETLSLRMARHVE 302 Query: 290 NALALAQMLQADERVAAVYYPGLESHPQHALSKALF-RSFGSLMSFELKDGID-CFDYLN 347 NA +A+ L+AD+RV V Y GL S P K + R G+L +F +K G + C ++ Sbjct: 303 NAEKIAKWLEADDRVEFVTYAGLPSSPYFERVKTVCPRGAGALFTFAVKGGYEACIKLVD 362 Query: 348 RLRLAIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADF 407 L + +NLGDTR+L+I A T ++ E++ + G A +++R+S+G+ED DDL+AD Sbjct: 363 SLEIFSHVANLGDTRSLIIHSASTTHRQLTPEQQEAAGAAPNVVRLSIGIEDADDLIADL 422 Query: 408 RQAL 411 QAL Sbjct: 423 DQAL 426 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 431 Length adjustment: 32 Effective length of query: 381 Effective length of database: 399 Effective search space: 152019 Effective search space used: 152019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory