Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate 3607759 Dshi_1168 aminotransferase class I and II (RefSeq)
Query= BRENDA::Q56232 (385 letters) >FitnessBrowser__Dino:3607759 Length = 391 Score = 170 bits (431), Expect = 6e-47 Identities = 119/378 (31%), Positives = 177/378 (46%), Gaps = 11/378 (2%) Query: 13 PSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPE 72 P + V A G ++ + G+P P + A L Q Y G+PE Sbjct: 11 PFIVMDVMEAARRAEAAGRHIIHMEVGQPGTAAPLPARRAVAAQLDQDAMGYTVALGLPE 70 Query: 73 LREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMV 132 LR A+A + R G+ + P +VT G A F D G V V P + SY +++ Sbjct: 71 LRRAIAGLYARWYGVDLDPARVVVTSGSSAAFLLAFTTYFDAGARVGVAEPGYPSYRQIL 130 Query: 133 RFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARL 192 + V + T PE G E + +A ++ SPNNPTG + ++ L AL Sbjct: 131 KALSLAPVGLPTQPETGHRMTAEALAQA---DIAGAIIASPNNPTGTMLDRDGLGALIAA 187 Query: 193 AVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEV 252 + D +SDEIY H L+ G+ + +N +K F+MTGWRIG+ P+ Sbjct: 188 CRDRDRVFISDEIY-HGLHYGDRAVSALEISDDVCVINSFSKYFSMTGWRIGWLVVPEAQ 246 Query: 253 IKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGL 312 ++ + ++ +AQ A L AL +A+R +E R Y R L+++GL A GL Sbjct: 247 VRVVERLAQNMFICAPHVAQIAALGAL--GDAARPELEANRAVYAANRQLVIDGLRAAGL 304 Query: 313 KA-VRPSGAFYVLMDTSPIAPD-EVRAAERLLEAGVAVVPGTDF---AAFGHVRLSYATS 367 A P GAFYV +DT ++ D AA+ L +AGVAV PG DF G +RLSYA + Sbjct: 305 DAFAPPDGAFYVYVDTGALSSDSRTLAADILEKAGVAVTPGLDFDPVRGHGTLRLSYARA 364 Query: 368 EENLRKALERFARVLGRA 385 E++ + + R A Sbjct: 365 TEDIAEGMTRLTNYFAAA 382 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 391 Length adjustment: 30 Effective length of query: 355 Effective length of database: 361 Effective search space: 128155 Effective search space used: 128155 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory