Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate 3608039 Dshi_1446 aminotransferase class-III (RefSeq)
Query= curated2:Q4A0N2 (394 letters) >FitnessBrowser__Dino:3608039 Length = 444 Score = 161 bits (408), Expect = 3e-44 Identities = 117/421 (27%), Positives = 199/421 (47%), Gaps = 56/421 (13%) Query: 26 GRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQRITMVSRALYSDNLGKWE 85 G G + D + Y+D G +V GH HP + AL Q +I ++ + Sbjct: 19 GAGCYIIDADGKRYLDGSGGAAVSCLGHDHPAVRAALHAQIDKIAFAHTGFFTSEPAEVL 78 Query: 86 -EKICKLANK--ENVLPMNTGTEAVETAIKMARKWGADIKNIDESSSEIIAMNGNFHGRT 142 + + A K E V ++ G+E+VE A+K+AR++ ++ + +IA ++HG T Sbjct: 79 CDALIAAAPKGIEKVYLLSGGSESVEAALKLARQFF--LETGEPRRHRVIARRQSYHGNT 136 Query: 143 LGSLSLSSQDSYKKGFGPLLNNIHYAD---------FGDIE-------------QLKKLI 180 LG+L+ ++ + PLL ++ D G+ + ++++L Sbjct: 137 LGALAAGGNAWRREKYAPLLVETYHIDPCYAYRHQAVGESDAAYGRRAADALRTEIERLG 196 Query: 181 NNQTTAIILEPIQGEGGVNIPPTH-FIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAME 239 A I EP+ G +PP + + +R++C+EY VLLI DE+ G+GRTG +FA E Sbjct: 197 PETVMAFIAEPVVGATAGAVPPAPGYFERIREICDEYGVLLILDEVMCGMGRTGTLFACE 256 Query: 240 WENTEPDIYLLGKSLGGGLYPISAVLANQDVMSVLTPGT----HGSTFGGNPLACAVSMA 295 + PDI + K LG G PI A+LA+ + + G+ HG T+ G+PLA A + A Sbjct: 257 QDGISPDIVTIAKGLGAGYAPIGAMLASGRIYDAIAQGSGSFQHGHTYHGHPLAAAAAGA 316 Query: 296 ALDVLNEEHLVQNALDLGDRLLKHLQQI--ESELIVEVRGRGLFIGIEL----------- 342 ++ L + G L L+ + + ++RGRGLF GIEL Sbjct: 317 VVETLRAPGTMAQVRAKGATLQSRLEAALGQHSHVGDIRGRGLFRGIELVEDRDTKRPLD 376 Query: 343 ---NVAAQDYCEQMINKGVLCKETQGNI-------IRIAPPLVIDKDEIDEVIRVITEVL 392 V+A+ M +G++C G I I +APP +I+ +ID ++ ++ E + Sbjct: 377 PARKVSARIKAAAMA-RGLICYPGSGTIDGKHGDHILLAPPFIIEDKQIDALVHMLAEAI 435 Query: 393 E 393 + Sbjct: 436 D 436 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 444 Length adjustment: 32 Effective length of query: 362 Effective length of database: 412 Effective search space: 149144 Effective search space used: 149144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory