GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Dinoroseobacter shibae DFL-12

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate 3606894 Dshi_0324 acetylglutamate kinase (RefSeq)

Query= BRENDA::Q9HTN2
         (301 letters)



>FitnessBrowser__Dino:3606894
          Length = 287

 Score =  288 bits (736), Expect = 1e-82
 Identities = 149/291 (51%), Positives = 198/291 (68%), Gaps = 13/291 (4%)

Query: 5   RDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVV 64
           + D    A+ LSEA+P++RR+    +VIK+GG+AM   E  A FARD+VLM+ VG+NPV+
Sbjct: 7   KSDWIATARTLSEAVPFLRRYDDAIVVIKFGGHAMGDAEAMASFARDIVLMRQVGVNPVI 66

Query: 65  VHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAI 124
           VHGGGP I  +L +L I S F++G RVTDAAT++VVEMVL G VNK IV  INR GG AI
Sbjct: 67  VHGGGPMINAMLAKLDINSDFVNGKRVTDAATIEVVEMVLSGLVNKRIVQAINREGGRAI 126

Query: 125 GLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAP 184
           GL+GKDA LI             +  P    +G VGE   V    L  LV+ + IPVIAP
Sbjct: 127 GLSGKDANLI-------------VCDPADPALGFVGEPVEVTPDTLLQLVRSEIIPVIAP 173

Query: 185 IGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIA 244
           IG G  GE++NIN D  AG +A ALKA++L+LLT+++G+ D QG+V+T L+ E + E+ A
Sbjct: 174 IGTGREGETFNINGDTAAGAIAAALKADRLLLLTDVSGVKDAQGKVVTELTVENIEEMTA 233

Query: 245 DGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295
            G I GGM+PK    + A++GGV +A I+DGR PNA LLE+FT+ G G++I
Sbjct: 234 AGVIAGGMIPKTETCVTAIRGGVRAAVILDGRAPNACLLELFTEHGAGSII 284


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 274
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 287
Length adjustment: 26
Effective length of query: 275
Effective length of database: 261
Effective search space:    71775
Effective search space used:    71775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate 3606894 Dshi_0324 (acetylglutamate kinase (RefSeq))
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.31670.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.31670.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.