Align N-acetyl-gamma-glutamyl-phosphate reductase; AGPR; EC 1.2.1.38; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase (uncharacterized)
to candidate N515DRAFT_3769 N515DRAFT_3769 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:B2FMD7 (317 letters) >FitnessBrowser__Dyella79:N515DRAFT_3769 Length = 319 Score = 447 bits (1150), Expect = e-130 Identities = 214/310 (69%), Positives = 261/310 (84%) Query: 7 TLGIVGARGHTGAELIKLVAAHPRLELAFVSSRERAGQRLSDHHPEFQGELQYENLDADA 66 T+GIVGARGHTGAELI+L+A HP LEL FVSSRE GQR+++H + GEL+Y NLD A Sbjct: 7 TIGIVGARGHTGAELIRLIATHPALELGFVSSRELDGQRVAEHVDGYAGELRYANLDPAA 66 Query: 67 VAAKGVDAVILALPNGLAAPFVAALEAAKPDTVIVDLSADYRFDNSWYYGLPELTRGRYN 126 VAA+G D V+LALPNG AAP+V A++AAKP+T+I+DLSADYRF+ WYYGLPELTRG++ Sbjct: 67 VAAQGADVVVLALPNGKAAPYVEAIDAAKPETLILDLSADYRFNERWYYGLPELTRGKWR 126 Query: 127 GQKHISNPGCYATAMQLAVHPLLDLLAGPPQCFGVSGYSGAGTTPSDKNNVELLADNLMP 186 G++ ISNPGCYATA+QL++ PL D+LA PP FGVSGYSGAGTTPSDKNN E L DNLMP Sbjct: 127 GERRISNPGCYATAIQLSIAPLKDVLAAPPVSFGVSGYSGAGTTPSDKNNPEKLRDNLMP 186 Query: 187 YALTNHVHEREVSVQLGVAVEFMPHVAPHFRGITLTANLWLNRVQTREQIVERFQQAYAG 246 Y+LT H HE+E S LG+ VEFMPHVAPHFRG+T+T NL+L R RE+I++RF+ AY G Sbjct: 187 YSLTGHTHEQEASRHLGLPVEFMPHVAPHFRGLTVTTNLYLVRPMKREEILQRFRHAYDG 246 Query: 247 EPLIEVLDEAPWVSRIAGRHGAQVGGFTLAPGGKRVVVVATLDNLLKGAATQAMQNLNLA 306 E L++V+DEAPWVS+IA RH A+VGGF ++ GKRVV+VATLDNLLKGAATQA+QN+N A Sbjct: 247 EKLVKVVDEAPWVSQIAHRHHAEVGGFAVSVDGKRVVIVATLDNLLKGAATQAIQNINRA 306 Query: 307 LGIDELTSIP 316 +G+DE TSIP Sbjct: 307 IGVDEYTSIP 316 Lambda K H 0.319 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 319 Length adjustment: 27 Effective length of query: 290 Effective length of database: 292 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_3769 N515DRAFT_3769 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.22018.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-96 307.3 0.0 3.7e-95 305.0 0.0 1.8 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 N515DRAFT_3769 N-acetyl-gamma-gl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 N515DRAFT_3769 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 305.0 0.0 3.7e-95 3.7e-95 2 340 .. 7 317 .. 6 319 .] 0.95 Alignments for each domain: == domain 1 score: 305.0 bits; conditional E-value: 3.7e-95 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssre.agkklsevhphlkglvd.lkleeleeeeil 65 +++ivGa+G+tGaeL+rl+a+Hp++e+ +vssre g++++e+++ + g+++ ++l++ +++ + lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 7 TIGIVGARGHTGAELIRLIATHPALELG-FVSSRElDGQRVAEHVDGYAGELRyANLDPAAVA--A 69 699************************9.9999999***************998899988777..6 PP TIGR01850 66 eeadvvflAlphgvsaelvpellekg..vkvidlSadfRlkdaevYekwYgkkhekeelleeavYG 129 + advv+lAlp+g +a++v+++ +++ + ++dlSad+R+++ +++YG lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 70 QGADVVVLALPNGKAAPYVEAIDAAKpeTLILDLSADYRFNE-------------------RWYYG 116 79******************998855459************4...................478** PP TIGR01850 130 lpElnreeikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfae 195 lpEl+r + ++ ++i+nPGCyaTa++L++aPl + + ++ +++sG+SgAG+++s+k++ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 117 LPELTRGKWRGERRISNPGCYATAIQLSIAPLKDVLAAP---PVSFGVSGYSGAGTTPSDKNNPEK 179 ********************************8655443...69********************** PP TIGR01850 196 vnenlkpYkvtkHrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrkl 261 +++nl+pY++t+H H++E +++l+ v+f+ph++p++rG++ t+++ l +++++ee+ + lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 180 LRDNLMPYSLTGHTHEQEASRHLG------LPVEFMPHVAPHFRGLTVTTNLYLVRPMKREEILQR 239 ************************......78********************************** PP TIGR01850 262 yeevYedepfvrvlkegelPstkavlgsnfvdig.vavdeetkrvvvvsaiDNLvKGaagqAvqnl 326 ++++Y++e++v+v++ e+P+++++++++++++g +av + krvv+v+++DNL+KGaa+qA+qn+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 240 FRHAYDGEKLVKVVD--EAPWVSQIAHRHHAEVGgFAVSVDGKRVVIVATLDNLLKGAATQAIQNI 303 **************9..9***************99******************************* PP TIGR01850 327 NlmlgfdetegLek 340 N ++g de+++++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3769 304 NRAIGVDEYTSIPL 317 **********9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.05 # Mc/sec: 1.96 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory