GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argD'B in Dyella japonica UNC79MFTsu3.2

Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate N515DRAFT_3308 N515DRAFT_3308 acetylornithine/N-succinyldiaminopimelate aminotransferase

Query= BRENDA::O30508
         (406 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3308 N515DRAFT_3308
           acetylornithine/N-succinyldiaminopimelate
           aminotransferase
          Length = 411

 Score =  368 bits (945), Expect = e-106
 Identities = 193/393 (49%), Positives = 258/393 (65%), Gaps = 3/393 (0%)

Query: 15  RYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRI 74
           RY +P Y P   +   G+G+RVWD  GR+ +D   GIAV +LGH  P LV AL  QA+++
Sbjct: 16  RYWLPVYRPREVVLDHGKGARVWDTEGRDYVDLGAGIAVNALGHQDPDLVDALVTQARKL 75

Query: 75  WHVSNVFTNEPALRLARKLVDAT-FAERVFLANSGAEANEAAFKLARRYA-NDVYGPQKY 132
           WH SNVF  EP L LA +LV A+ FAERVFL NSG EANEAA KL R++A +    P++ 
Sbjct: 76  WHSSNVFYTEPPLHLAEELVQASGFAERVFLCNSGTEANEAAIKLVRKWAASKGRAPEQR 135

Query: 133 EIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISD-KTCAVV 191
            I+    SFHGRTL  V    QPKY + + P   G  ++ +ND+  L+AA +     AV+
Sbjct: 136 VILTFRGSFHGRTLAAVTATAQPKYQENYEPLPGGFRYLDFNDVAGLEAAFAQGDVAAVM 195

Query: 192 LEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDIL 251
           LEP+QGEGGVLPA  A++  AR+LCD H ALLV DE+Q GMGR G LFA+   GV PDI+
Sbjct: 196 LEPVQGEGGVLPASPAFIRRARELCDTHEALLVLDEIQCGMGRTGTLFAHAQDGVTPDIV 255

Query: 252 SSAKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGV 311
           + AK+LG GFPIGAML   ++A+ +  G HGTT+GGNP+A+AVA  AL  + + E++  V
Sbjct: 256 TLAKALGCGFPIGAMLAGPKVAEVMQYGAHGTTFGGNPMAAAVARVALRKLASAELMANV 315

Query: 312 KAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQA 371
             + +  +  L  I  E  +F E+RG GL++GA L + +KG+A +VL+ A    ++VLQA
Sbjct: 316 AKQAQALRDGLAAIDGELKLFAEVRGRGLMLGAVLAEAYKGRAGEVLDHAAAHGLLVLQA 375

Query: 372 SPDVVRFAPSLVIDDAEIDEGLERFERAVAKLV 404
            PDV+RF P L I DA++ EGL R   A+A  V
Sbjct: 376 GPDVLRFVPPLNITDADLAEGLARLRAALADFV 408


Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 484
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 406
Length of database: 411
Length adjustment: 31
Effective length of query: 375
Effective length of database: 380
Effective search space:   142500
Effective search space used:   142500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory