Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate N515DRAFT_1776 N515DRAFT_1776 aspartate carbamoyltransferase
Query= BRENDA::Q48296 (295 letters) >FitnessBrowser__Dyella79:N515DRAFT_1776 Length = 309 Score = 107 bits (266), Expect = 4e-28 Identities = 97/306 (31%), Positives = 151/306 (49%), Gaps = 25/306 (8%) Query: 1 MEHLVDINDVESEEIEQLLDLAASMKENPGEFSGVMD---NKSLVMLFAKPSTRTRLSFE 57 + HL + ++ IE+LLD A +M++ + +D ++++ LF +PSTRTR SFE Sbjct: 5 LRHLTTLENMPRATIERLLDRAVAMRDACAHGTRKLDLLAGRTILNLFFEPSTRTRTSFE 64 Query: 58 TGMTQLGGHGIFFEMGSSQLSRGEPISDVSQVM-SRYEDAIMARLFEHDEMMELAENA-- 114 +LG I F++G S S+GE + D + + + DAI+ R EL +A Sbjct: 65 LAARRLGADVINFDIGFSSTSKGEELYDTLHTLEAMHLDAIVVRHKISGTPDELVRHAMS 124 Query: 115 DVPVVN-GLTDFLHPCQALTDMFTM-QEKDRLDTLAFV--GD--GNNVAHSLMQASAKMG 168 V V+N G + HP Q L D T+ Q + + L V GD + VA S + A A +G Sbjct: 125 GVSVINAGDGNRAHPTQGLLDALTIRQHRPNFEQLGVVICGDVKHSRVARSDVHALAALG 184 Query: 169 V-DCRIATPEGMEPDEEIQDRVSDANVTVTNDPYEAVDGATAVYGDVFVSMGEEEQREEK 227 V D R+ P + P E + D EAV GA AV + + + +E Sbjct: 185 VRDIRLCAPAALMPGEH-----ELPHCQRFTDFDEAVTGADAV---IMLRLQKERMAATD 236 Query: 228 LAE----FDGFQIDQDLMDAARDDAIFMHCLPAHRGEEVTAEVADGPQSVIFDQAENRMH 283 L + F + +D + A A+ MH P +RG E+++EVADG QS I +Q N + Sbjct: 237 LQDEADYFRHYGLDTRRLALAARSALVMHPGPLNRGIEISSEVADGAQSRILEQVGNGVF 296 Query: 284 VQKAIV 289 V+ A++ Sbjct: 297 VRMAVL 302 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 309 Length adjustment: 27 Effective length of query: 268 Effective length of database: 282 Effective search space: 75576 Effective search space used: 75576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory