Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate N515DRAFT_2714 N515DRAFT_2714 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__Dyella79:N515DRAFT_2714 Length = 375 Score = 512 bits (1318), Expect = e-150 Identities = 249/374 (66%), Positives = 299/374 (79%), Gaps = 3/374 (0%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 ALL LEDG+ FHG+A+GATG VGEVVFNT+MTGYQEILTDPSYSRQIVTLTYPHIGN G Sbjct: 5 ALLALEDGSVFHGQAVGATGETVGEVVFNTAMTGYQEILTDPSYSRQIVTLTYPHIGNTG 64 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 N D ES VHA GL++RD+P ASN+R++E L YLKR IVAIA IDTR+LTR+LR+ Sbjct: 65 VNAEDAESLAVHAAGLIVRDVPRRASNWRSSESLPDYLKRLGIVAIAGIDTRRLTRILRD 124 Query: 125 KGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEA 184 KGA GCI+AG++ DA AL KARAFPGLNGMDLAK V+ + Y+W +GS+ L +A Sbjct: 125 KGALAGCIVAGEHVDAEAALAKARAFPGLNGMDLAKVVSVTKPYAWKEGSYDLDR---QA 181 Query: 185 KKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGD 244 ++ L F VVAYD+G K NILR+L +GC +T+VPAQT A +VL M PDG+FLSNGPGD Sbjct: 182 FEQPALRFKVVAYDYGVKFNILRLLAAQGCDITVVPAQTPAAEVLAMKPDGVFLSNGPGD 241 Query: 245 PAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNV 304 PA CDYA+ A ++FL+ IP+FGICLGHQ++ LA GAKT+KMKFGHHG NHPVKD + Sbjct: 242 PAACDYAVAATREFLDAKIPLFGICLGHQIMGLALGAKTLKMKFGHHGANHPVKDHDDGR 301 Query: 305 VMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAA 364 V+IT+QNHGFAVD ATLPAN+RVTH SLFDG+LQG TD+PAF FQGHPEASPGPHD Sbjct: 302 VLITSQNHGFAVDPATLPANVRVTHSSLFDGSLQGFALTDRPAFCFQGHPEASPGPHDIG 361 Query: 365 PLFDHFIELIEQYR 378 LF+ F +L+++ R Sbjct: 362 YLFERFAQLMQESR 375 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 375 Length adjustment: 30 Effective length of query: 352 Effective length of database: 345 Effective search space: 121440 Effective search space used: 121440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate N515DRAFT_2714 N515DRAFT_2714 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.28510.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-149 482.9 0.0 3.2e-149 482.7 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 N515DRAFT_2714 carbamoyl-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 N515DRAFT_2714 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 482.7 0.0 3.2e-149 3.2e-149 1 360 [. 5 372 .. 5 373 .. 0.96 Alignments for each domain: == domain 1 score: 482.7 bits; conditional E-value: 3.2e-149 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneeda 66 a l+ledG+vf+g+++ga++e+vGevvFnT+mtGYqEiltDpsY++qiv+ltyp+ign+gvn+eda lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 5 ALLALEDGSVFHGQAVGATGETVGEVVFNTAMTGYQEILTDPSYSRQIVTLTYPHIGNTGVNAEDA 70 579*************************************************************** PP TIGR01368 67 eskkikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistek 132 es ++++gl+v+++ +++sn+r++esL ++lk+ givai+g+DTR l++ lR+kg+++++i++ + lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 71 ESLAVHAAGLIVRDVPRRASNWRSSESLPDYLKRLGIVAIAGIDTRRLTRILRDKGALAGCIVAGE 136 ************************************************************998866 PP TIGR01368 133 .sekeelvekakespkvkevnlvkevstkeayeleq.......k.akkegkklrvvvidlGvKeni 189 +++e + +ka++ p +++++l+k vs++++y++++ + ++ + +vv++d+GvK ni lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 137 hVDAEAALAKARAFPGLNGMDLAKVVSVTKPYAWKEgsydldrQaFEQPALRFKVVAYDYGVKFNI 202 1568889999*************************987766542345555569************* PP TIGR01368 190 lreLvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclG 255 lr L+++g+++tvvpa+t+a+e+ +++pdg++lsnGPGdPaa+++a++ ++++l+akiP+fGIclG lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 203 LRLLAAQGCDITVVPAQTPAAEVLAMKPDGVFLSNGPGDPAACDYAVAATREFLDAKIPLFGICLG 268 ****************************************************************** PP TIGR01368 256 hqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgt 321 hq+++lalgakt+k+kfGh+GaNhpvkd+++grv itsqNHg+avd+++l+++ ++vth +l+Dg+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 269 HQIMGLALGAKTLKMKFGHHGANHPVKDHDDGRVLITSQNHGFAVDPATLPAN-VRVTHSSLFDGS 333 *************************************************8866.************ PP TIGR01368 322 veglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 ++g + ++ p+f Q HPeaspGphd ylF++f +l++ lcl|FitnessBrowser__Dyella79:N515DRAFT_2714 334 LQGFALTDRPAFCFQGHPEASPGPHDIGYLFERFAQLMQ 372 ************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory