Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate N515DRAFT_1068 N515DRAFT_1068 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
Query= BRENDA::C3TIE2 (350 letters) >FitnessBrowser__Dyella79:N515DRAFT_1068 Length = 365 Score = 424 bits (1090), Expect = e-123 Identities = 214/344 (62%), Positives = 254/344 (73%) Query: 6 DDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHD 65 DDLRI+ I L P ++ A E A +TVAHAR A+H IL G DDRL+VVIGPCSIHD Sbjct: 7 DDLRIRAITPLSTPAEVMRDCHAGELALDTVAHARAAVHDILAGQDDRLVVVIGPCSIHD 66 Query: 66 PVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRI 125 AA EYA RLL R D LEIVMRVYFEKPRTTVGWKGLINDP +D SF+I+ GLR+ Sbjct: 67 TAAAMEYARRLLGQRRRFADTLEIVMRVYFEKPRTTVGWKGLINDPDLDGSFRIDKGLRL 126 Query: 126 ARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGF 185 AR LL DIN G+PA EFLDMITPQY+ADL++WGAIGARTTESQVHRELASGLSCPVGF Sbjct: 127 ARTLLRDINQLGVPAGCEFLDMITPQYIADLVAWGAIGARTTESQVHRELASGLSCPVGF 186 Query: 186 KNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKH 245 KNGTDG +K+A+DA+ AA PH F++VTK G +AI +T GN DCH+ILRGGK+PNY A Sbjct: 187 KNGTDGNVKIAVDAVQAASQPHHFMAVTKDGRTAIASTMGNEDCHVILRGGKQPNYDAAS 246 Query: 246 VAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHL 305 V E + + GL ++M+D SHANSSKQ + Q V D+ Q+ GE+ IIGVMVESHL Sbjct: 247 VDAACEAIARGGLSPRLMVDASHANSSKQPENQPLVIDDIALQLEDGERRIIGVMVESHL 306 Query: 306 VEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 + G Q L + L YG+SITD CI W + +L +L AV+ RR Sbjct: 307 LGGRQELVPEQSLRYGQSITDGCIDWNASVGVLERLDEAVRRRR 350 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 365 Length adjustment: 29 Effective length of query: 321 Effective length of database: 336 Effective search space: 107856 Effective search space used: 107856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_1068 N515DRAFT_1068 (3-deoxy-D-arabinoheptulosonate-7-phosphate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.5848.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-162 524.0 0.0 7.7e-162 523.8 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 N515DRAFT_1068 3-deoxy-D-arabino Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 N515DRAFT_1068 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 523.8 0.0 7.7e-162 7.7e-162 1 342 [] 7 350 .. 7 350 .. 0.99 Alignments for each domain: == domain 1 score: 523.8 bits; conditional E-value: 7.7e-162 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaale 66 ddlri +i +l tP+e+++ + e a ++va++r +++dilaG+ddrl+vviGPcsihd aa+e lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 7 DDLRIRAITPLSTPAEVMRDCHAGELALDTVAHARAAVHDILAGQDDRLVVVIGPCSIHDTAAAME 72 799*************************************************************** PP TIGR00034 67 yakrlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelg 132 ya+rl + ++ d leivmrvyfekPrttvGWkGlindPdl++sf+++kGlr+ar ll d+++lg lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 73 YARRLLGQRRRFADTLEIVMRVYFEKPRTTVGWKGLINDPDLDGSFRIDKGLRLARTLLRDINQLG 138 ****************************************************************** PP TIGR00034 133 lplatelldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaa 198 +p+++e+ld+i+pqy+adl++wgaiGarttesqvhrelasgls+pvgfkngtdG++k+a+da++aa lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 139 VPAGCEFLDMITPQYIADLVAWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAVQAA 204 ****************************************************************** PP TIGR00034 199 aaehlflsvtkaGqvaivetkGnedghiilrGGkkpnydaedvaevkeelekaglkeelmidfshg 264 +++h+f++vtk+G++ai +t Gned+h+ilrGGk+pnyda++v++++e + + gl+++lm+d+sh+ lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 205 SQPHHFMAVTKDGRTAIASTMGNEDCHVILRGGKQPNYDAASVDAACEAIARGGLSPRLMVDASHA 270 ****************************************************************** PP TIGR00034 265 nsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl..keelkyGksvtdacigwedte 328 ns+k+ ++q+ v ++++ q+++Ge+ iiGvm+es+l +G+q+l +++l yG+s+td ci+w+ + lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 271 NSSKQPENQPLVIDDIALQLEDGERRIIGVMVESHLLGGRQELvpEQSLRYGQSITDGCIDWNASV 336 ******************************************98999******************* PP TIGR00034 329 allrklaeavkerr 342 +l++l eav++rr lcl|FitnessBrowser__Dyella79:N515DRAFT_1068 337 GVLERLDEAVRRRR 350 ***********986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.79 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory