Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate N515DRAFT_2936 N515DRAFT_2936 histidinol-phosphate aminotransferase
Query= SwissProt::P06986 (356 letters) >FitnessBrowser__Dyella79:N515DRAFT_2936 Length = 353 Score = 272 bits (695), Expect = 1e-77 Identities = 151/353 (42%), Positives = 210/353 (59%), Gaps = 2/353 (0%) Query: 4 VTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFQLTQQTLNRYPECQPKAV 63 +++ DLAR +R + PY SAR G + LNANE A + + NRYP+ QP A+ Sbjct: 1 MSVLDLARPELRAMQPYSSARMEASGGAILLNANESAWAPAGE-AGRGCNRYPDPQPAAL 59 Query: 64 IENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIGVE 123 + A GV+ EQ+LV RG+DE I+LL+RAFC G+DAI PPT+GMYSV A Sbjct: 60 LRALAALYGVREEQLLVGRGSDEAIDLLVRAFCRAGRDAIAIQPPTFGMYSVCARIQDAG 119 Query: 124 CRTVPTLDNWQLDLQGISDKLD-GVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVV 182 VP ++ +D + L VK+V+VC+PNNPTGQ + L G+A++V Sbjct: 120 IVEVPLAADFTVDADALLAALTPAVKLVFVCTPNNPTGQPVPRATIERLARELAGRALLV 179 Query: 183 ADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAP 242 DEAY+EF S+AG + Y +LA+LRTLSKA+ALAG R G LA+ EVI LL K+I P Sbjct: 180 VDEAYVEFADGGSVAGLIDTYDNLAVLRTLSKAWALAGARIGTLLAHAEVIALLRKIIPP 239 Query: 243 YPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYILA 302 YPL P A + LS QG E + + AER + AL +P V +V S+ N++ Sbjct: 240 YPLPLPCVTAALEGLSAQGQAEAAEHIRIVRAERARMTPALAALPGVREVLPSQANFLAV 299 Query: 303 RFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRAEQ 355 RF + A ++ L+ GI++RD + P+L LRIT+GT E+ RV+D L ++ Sbjct: 300 RFDDAGAAYQRLFAAGIVVRDVRRYPNLGDALRITIGTPAENARVLDVLNGDR 352 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 353 Length adjustment: 29 Effective length of query: 327 Effective length of database: 324 Effective search space: 105948 Effective search space used: 105948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_2936 N515DRAFT_2936 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.19707.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-109 352.6 0.0 1.2e-109 352.4 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 N515DRAFT_2936 histidinol-phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 N515DRAFT_2936 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 352.4 0.0 1.2e-109 1.2e-109 1 347 [. 8 349 .. 8 350 .. 0.97 Alignments for each domain: == domain 1 score: 352.4 bits; conditional E-value: 1.2e-109 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealak 66 r+++++++pY++ ar + + + Ln+nE++++p ++ + +rYpdpq+++l +ala+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 8 RPELRAMQPYSS-ARMEASGGAILLNANESAWAPAG----EA---GRGCNRYPDPQPAALLRALAA 65 789*********.78888889*************93....33...3468***************** PP TIGR01141 67 ylgveeenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqe 131 +gv ee++l+g+Gsde+i+ll+raf+ g da+++ +pt+ mY+v+a+i++a ++evpl++d++ lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 66 LYGVREEQLLVGRGSDEAIDLLVRAFCRAGrDAIAIQPPTFGMYSVCARIQDAGIVEVPLAADFTV 131 ******************************9*********************************** PP TIGR01141 132 dleavleaakekvklvflasPnnPtGnllkreeiekvleeve.dalVVvDeAYieFseeasvlell 196 d +a+l+a + vklvf+++PnnPtG+ + r+ ie+++ e + +al VvDeAY+eF++ sv+ l+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 132 DADALLAALTPAVKLVFVCTPNNPTGQPVPRATIERLARELAgRALLVVDEAYVEFADGGSVAGLI 197 *****************************************55*********************** PP TIGR01141 197 aeypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsd..kie 260 y+nl+vlrTlSKa +LAg R+G ++a+ae+i l+k+++py+++ ++++aa++ l+ + + + lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 198 DTYDNLAVLRTLSKAWALAGARIGTLLAHAEVIALLRKIIPPYPLPLPCVTAALEGLSAQGqaEAA 263 **********************************************************99977889 PP TIGR01141 261 ktveevkkererlleelkklegle.vyeSkaNFvlikvkedaeelleallekgiivRdlksaegll 325 + ++ v++er+r++ +l++l+g++ v +S+aNF+ ++++ da +++++l +gi+vRd++ +++ l lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 264 EHIRIVRAERARMTPALAALPGVReVLPSQANFLAVRFD-DAGAAYQRLFAAGIVVRDVRRYPN-L 327 99************************************9.**********************88.5 PP TIGR01141 326 eeclRitvGtreenerllealk 347 ++lRit+Gt+ en r+l++l+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2936 328 GDALRITIGTPAENARVLDVLN 349 ******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory