Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate N515DRAFT_2931 N515DRAFT_2931 phosphoribosyl-ATP pyrophosphatase /phosphoribosyl-AMP cyclohydrolase
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >FitnessBrowser__Dyella79:N515DRAFT_2931 Length = 209 Score = 219 bits (558), Expect = 3e-62 Identities = 115/197 (58%), Positives = 140/197 (71%), Gaps = 3/197 (1%) Query: 10 LDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSG 69 LDW K DGL+P IVQH ++GEVLMLGYMN EAL +L S +VTFFSR+KQRLWTKGE+SG Sbjct: 11 LDWSKGDGLLPAIVQHWLTGEVLMLGYMNAEALAHSLSSAQVTFFSRSKQRLWTKGESSG 70 Query: 70 NFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFG---DTAHQWLFLYQLEQLLAERK 126 + L + S DCD DTLL+ A P GPTCH GTSSCFG D A FL L++L+ +R Sbjct: 71 HVLALKSARIDCDGDTLLLQAEPQGPTCHLGTSSCFGERADVAPPLGFLATLDRLVEQRA 130 Query: 127 SADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQD 186 + P SYT +L+ G +RIAQKVGEEGVETALAA V D L EA+DL++HL+V L+ Sbjct: 131 AERPAGSYTTRLFEDGIRRIAQKVGEEGVETALAAVVQDDEALLGEAADLVFHLMVALRA 190 Query: 187 QGLDLTTVIENLRKRHQ 203 +GL + V L RHQ Sbjct: 191 RGLSTSDVCRVLEARHQ 207 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 209 Length adjustment: 21 Effective length of query: 182 Effective length of database: 188 Effective search space: 34216 Effective search space used: 34216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
Align candidate N515DRAFT_2931 N515DRAFT_2931 (phosphoribosyl-ATP pyrophosphatase /phosphoribosyl-AMP cyclohydrolase)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.23851.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-32 97.6 0.0 2.7e-32 97.1 0.0 1.2 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2931 N515DRAFT_2931 phosphoribosyl-AT Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2931 N515DRAFT_2931 phosphoribosyl-ATP pyrophosphatase /phosphoribosyl-AMP cy # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.1 0.0 2.7e-32 2.7e-32 1 84 [] 119 202 .. 119 202 .. 0.98 Alignments for each domain: == domain 1 score: 97.1 bits; conditional E-value: 2.7e-32 TIGR03188 1 leeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhl 66 l +L++++e+r++e+p +Syt++l+e+g+++i++KvgEE vE+++aa+ +d+e+l+ EaaDl++hl lcl|FitnessBrowser__Dyella79:N515DRAFT_2931 119 LATLDRLVEQRAAERPAGSYTTRLFEDGIRRIAQKVGEEGVETALAAVVQDDEALLGEAADLVFHL 184 6789************************************************************** PP TIGR03188 67 lVllaekgvsledvlaeL 84 +V+l+++g+s +dv+++L lcl|FitnessBrowser__Dyella79:N515DRAFT_2931 185 MVALRARGLSTSDVCRVL 202 **************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (209 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory