Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate N515DRAFT_0955 N515DRAFT_0955 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::A5F699 (292 letters) >FitnessBrowser__Dyella79:N515DRAFT_0955 Length = 301 Score = 138 bits (348), Expect = 1e-37 Identities = 90/290 (31%), Positives = 147/290 (50%), Gaps = 2/290 (0%) Query: 1 MFSGSIVALITPFTPDGEVDYISLKKLVDFHVDAGTDAIVSVGTTGESATLTVEEHVKVV 60 ++ G I A+ TPFT DG+VD+ L K + +DAG IV +G+ GE+ATL+ EE V+++ Sbjct: 6 IWRGVIPAITTPFTADGQVDHAFLGKHANQLIDAGCTGIVPLGSLGEAATLSFEEKVEII 65 Query: 61 AKTVEFAEGRLPIIAGTGANATHEAVTFSRLLNNTGIAGYLSVTPYYNKPTQEGLFLHYN 120 V+ GR P+I G A +T EAV ++ G +G + + PY + H Sbjct: 66 RTLVKALNGRAPVIPGIAALSTAEAVRLAKEAKALGCSGLMVLPPYVYSTDWREMGAHLR 125 Query: 121 AIAQETDIPVILYNVPGRTAVDMRPETVARLS-EIKNIVALKDATGDLSRVAKHREMCKE 179 A+ TD+P +LYN P D PE +A L+ E N+ A+K+++GD+ R A R + + Sbjct: 126 AVIAATDLPCMLYNNPVAYKTDFAPEQIAELAHEFPNVQAVKESSGDVRRFAGIRALLGD 185 Query: 180 GFVLLSGDDATGLEFVKLGGQGVISVTNNIAAADMAKMMHLALDGKFDEAASINQRLMTL 239 LL G D +E V +G +G I+ N + K+ LA DG D A + + + L Sbjct: 186 RVELLVGMDDAIVEGVAMGARGWIAGLVNAYPKESVKLFELARDGGADAALELYRWFLPL 245 Query: 240 HKNLFIESSPIPVKWAAHKMGLIANGDLRLPLTQLSEPARPIVAQALSEA 289 + + + +K K+G+ + +R P ++ R + + A Sbjct: 246 LRLDTVPTFVQLIKLVQAKVGM-GSEQVRAPRLAVAGAEREAALRVIDHA 294 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 301 Length adjustment: 26 Effective length of query: 266 Effective length of database: 275 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory