Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate N515DRAFT_2936 N515DRAFT_2936 histidinol-phosphate aminotransferase
Query= BRENDA::P9WPZ5 (397 letters) >FitnessBrowser__Dyella79:N515DRAFT_2936 Length = 353 Score = 73.6 bits (179), Expect = 9e-18 Identities = 63/204 (30%), Positives = 98/204 (48%), Gaps = 17/204 (8%) Query: 53 GVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEV 112 G N+YP P A L RA+AA +GV E ++LV G+ EAI V G + Sbjct: 47 GCNRYPD-PQPAALLRALAAL----YGVR---EEQLLVGRGSDEAIDLLVRAFCRAGRDA 98 Query: 113 LLIEP-FYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNP 171 + I+P + YS + A V VPL D F +DADAL A+TP + + + +P+NP Sbjct: 99 IAIQPPTFGMYSVCARIQDAGIVEVPLAAD---FTVDADALLAALTPAVKLVFVCTPNNP 155 Query: 172 TGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAA 231 TG + + +A +A +++ DE Y + A +AG + + + + Sbjct: 156 TGQPVPRATIERLAR-ELAGRALLVVDEAY----VEFADGGSVAGLIDTYDNLAVLRTLS 210 Query: 232 KMFNCTGWKIGWACGPAELIAGVR 255 K + G +IG AE+IA +R Sbjct: 211 KAWALAGARIGTLLAHAEVIALLR 234 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 353 Length adjustment: 30 Effective length of query: 367 Effective length of database: 323 Effective search space: 118541 Effective search space used: 118541 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory