Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate N515DRAFT_0745 N515DRAFT_0745 succinyldiaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__Dyella79:N515DRAFT_0745 Length = 377 Score = 424 bits (1089), Expect = e-123 Identities = 209/371 (56%), Positives = 257/371 (69%), Gaps = 2/371 (0%) Query: 8 ELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAPVVCFAG 67 +L ELI R SVTPDD CQ LLA RL ++GF E L +G+ N+W G P++ F G Sbjct: 6 DLTAELIRRRSVTPDDAGCQALLAGRLARVGFKVEHLRYGEVDNLWATHGEGGPLLMFLG 65 Query: 68 HTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNHQGSI 127 HTDVVPTGP E W S PFEPA RDG LYGRGAADMK S+A A E FV HP+H+G + Sbjct: 66 HTDVVPTGPAESWRSDPFEPAVRDGYLYGRGAADMKGSVAAMAVALEAFVTAHPDHRGRV 125 Query: 128 ALLITSDEEGDA-LDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRGSLSGN 186 L+TSDEEG LDG KV + +A E ID+C+VGEP++ ++LGD+I+ GRRGSLS Sbjct: 126 GFLMTSDEEGPTNLDGVRKVAEHFRASGERIDWCVVGEPSSKERLGDLIRVGRRGSLSAT 185 Query: 187 LTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGGTGATN 246 LTV+G QGH+AYP A NP+H FAPAL EL E WDEGN FPPTSFQ+SN+N GTGATN Sbjct: 186 LTVRGIQGHVAYPEKAKNPIHAFAPALAELAAERWDEGNVDFPPTSFQVSNLNAGTGATN 245 Query: 247 VIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQA-GKLTDV 305 VIPG L NFR+ST S L++RV ILD+H + Y L W+ SG+PFL A G L D Sbjct: 246 VIPGALVALVNFRYSTASRAEALRERVERILDRHKLDYALDWNLSGEPFLCPAGGALRDT 305 Query: 306 ARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDIPKLS 365 + + CG+E E ST GGTSDGRFI + E++ELGP NATIH+++E V + D+ KL Sbjct: 306 VVSVCRDLCGVEPEQSTGGGTSDGRFIAPLGAEVVELGPVNATIHKVDECVAVADLDKLP 365 Query: 366 AVYEGILARLL 376 ++Y I RLL Sbjct: 366 SLYRAICERLL 376 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 377 Length adjustment: 30 Effective length of query: 351 Effective length of database: 347 Effective search space: 121797 Effective search space used: 121797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate N515DRAFT_0745 N515DRAFT_0745 (succinyldiaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.32582.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-162 526.3 0.0 2.4e-162 526.1 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 N515DRAFT_0745 succinyldiaminopi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 N515DRAFT_0745 succinyldiaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 526.1 0.0 2.4e-162 2.4e-162 2 370 .] 5 375 .. 4 375 .. 0.98 Alignments for each domain: == domain 1 score: 526.1 bits; conditional E-value: 2.4e-162 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvv 67 ++l+ eLi+r+svtP+dag+q+l+a rL ++gf++e+l+++++ nlwat+g + p l+f GhtDvv lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 5 FDLTAELIRRRSVTPDDAGCQALLAGRLARVGFKVEHLRYGEVDNLWATHGEGGPLLMFLGHTDVV 70 7899************************************************************** PP TIGR01246 68 PaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeege 133 P+G+ e+W+sdpfep++rdG+lygrGaaDmkgs+aa+ va e fv++++dh+G++++l+tsDeeg lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 71 PTGPAESWRSDPFEPAVRDGYLYGRGAADMKGSVAAMAVALEAFVTAHPDHRGRVGFLMTSDEEGP 136 *****************************************************************6 PP TIGR01246 134 .aidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkae 198 +dG++kv+e +++ e id++vvgePss+++lGD+i++GrrGs++++l+++GiqGhvaYP+ka+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 137 tNLDGVRKVAEHFRASGERIDWCVVGEPSSKERLGDLIRVGRRGSLSATLTVRGIQGHVAYPEKAK 202 268*************************************************************** PP TIGR01246 199 nPvhkavpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeel 264 nP+h ++p+l+el+a+++DeGn fpp+s+q++n++agtga+nviPg+l + n+r+s+ + +e l lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 203 NPIHAFAPALAELAAERWDEGNVDFPPTSFQVSNLNAGTGATNVIPGALVALVNFRYSTASRAEAL 268 ****************************************************************** PP TIGR01246 265 kskvekildkhkldYelewklsgepfltk.egklikkvaeaieevlkkkpelstsGGtsDarfiak 329 +++ve+ild+hkldY l+w+lsgepfl g l ++v+++ + +++ +pe st+GGtsD+rfia lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 269 RERVERILDRHKLDYALDWNLSGEPFLCPaGGALRDTVVSVCRDLCGVEPEQSTGGGTSDGRFIAP 334 ****************************96789999****************************** PP TIGR01246 330 lgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 lgaevvelG+vn+tihkv+e+v ++dl+kl ++y+ + e+l lcl|FitnessBrowser__Dyella79:N515DRAFT_0745 335 LGAEVVELGPVNATIHKVDECVAVADLDKLPSLYRAICERL 375 ***********************************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.58 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory