GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hicdh in Dyella japonica UNC79MFTsu3.2

Align isocitrate dehydrogenase (NAD+) (EC 1.1.1.41) (characterized)
to candidate N515DRAFT_1138 N515DRAFT_1138 isocitrate dehydrogenase (NAD+)

Query= BRENDA::P50213
         (366 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1138 N515DRAFT_1138
           isocitrate dehydrogenase (NAD+)
          Length = 338

 Score =  307 bits (787), Expect = 2e-88
 Identities = 164/337 (48%), Positives = 224/337 (66%), Gaps = 8/337 (2%)

Query: 32  QTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWE--ERNVTAIQGPGGKWMIPSEAKESMD 89
           +T+ +IPGDGIGPEI  A +++ DA    + +E  +  + A++  G   ++P +  +++ 
Sbjct: 3   KTIAVIPGDGIGPEIMKATLRVLDALDCGLSYEFVDAGMVALEKHGD--LLPKDTLDAIA 60

Query: 90  KNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENT 149
           ++ + LKGPL TPI  G  S+N+ LR+ FDLYANVRP +S  G K  + +++I+T+RENT
Sbjct: 61  RHTIALKGPLTTPIGGGFTSINVTLRRHFDLYANVRPAISFPGTKARFENIDIITVRENT 120

Query: 150 EGEY-SGIEHVIVDG-VVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMS 207
           EG Y S  + +  DG V  S+   T   S RI ++AFE AR   R  +TAVHKANIM+ S
Sbjct: 121 EGAYLSEGQTLSEDGEVATSMVRNTRKGSTRIVKYAFEMARQKGRKKITAVHKANIMKTS 180

Query: 208 DGLFLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLI 267
            GLFL   REVA+   DI+FNEM +D  C+ +V  P QFDV+V  NL+GDILSDLCAGL+
Sbjct: 181 SGLFLNVAREVAKEYPDIEFNEMIVDNTCMQLVMKPEQFDVIVTTNLFGDILSDLCAGLV 240

Query: 268 GGLGVTPSGNIGANGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARI 327
           GGLG+ P  NIGA G AIFE+VHG+APDIAGK +ANP ALLL+A  ML H+G+ D   ++
Sbjct: 241 GGLGLAPGDNIGA-GAAIFEAVHGSAPDIAGKGIANPCALLLAAADMLDHLGMADKGNKV 299

Query: 328 EAACFATI-KDGKSLTKDLGGNAKCSDFTEEICRRVK 363
            AA   T+  D  ++T DLGG      F + I +RVK
Sbjct: 300 RAAIRDTLTNDRDAVTPDLGGKGNTDSFGDAIVKRVK 336


Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 348
Number of extensions: 17
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 366
Length of database: 338
Length adjustment: 29
Effective length of query: 337
Effective length of database: 309
Effective search space:   104133
Effective search space used:   104133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory