Align [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 (uncharacterized)
to candidate N515DRAFT_1751 N515DRAFT_1751 adenosylmethionine-8-amino-7-oxononanoate aminotransferase
Query= curated2:Q9RW75 (429 letters) >FitnessBrowser__Dyella79:N515DRAFT_1751 Length = 467 Score = 167 bits (422), Expect = 8e-46 Identities = 129/419 (30%), Positives = 206/419 (49%), Gaps = 56/419 (13%) Query: 30 MVRGQGATVWDENGRSYIDCVVGYGVATLGHSHPDVVKAVQEQAGKLM-VMPQTVPNDKR 88 +VRG+G + D +GR Y+D + + GH++P + A+++Q L V+ ++ Sbjct: 50 IVRGEGPWLVDADGRRYLDGISSWWTNLFGHANPRIGAALKQQLDTLEHVIFAGFTHEPA 109 Query: 89 AEFLQELVGVLPQGLDRVFLCNSGTEAMEAAKKFAIT------ATGRSRFVSMKRGFSGR 142 E + L + P GL+RVFL ++G+ A+E A K + A ++RF+++ + G Sbjct: 110 IELAERLAQITPAGLERVFLADNGSAAIEVALKMSFHYWLNQGAGQKTRFIALTGSYHGE 169 Query: 143 SLGALSFTWEPKYREPFG---------------DAVDNKSVDFVTYGNLDELRAAVTE-- 185 +LGALS + YR+ + +A +S + L ELR + + Sbjct: 170 TLGALSVSDVALYRKTYAPLLLTPVLAPSPDAYEAEPGESAEACAARRLGELRVLLEQHA 229 Query: 186 -QTAAVIMEP-VQGEGGVRPASAEFIQEARRITREKGALLILDEIQTGFCRTGKMFACEH 243 +T AVI+EP VQ GG+R ++ R + E G I DEI GF RTG +FACE Sbjct: 230 HETCAVIVEPLVQCAGGMRMYHPSYLTGLRALCDEFGVHFIADEIAVGFGRTGTLFACEQ 289 Query: 244 FGVIPDGMTLAKAIAGG--------TPTAAFAMMSEVADRMPAGGHGTTFGGNPLSMAAG 295 GV PD M L+K + GG T T + + A H ++ GNPL+ A Sbjct: 290 AGVSPDFMCLSKGLTGGFLPLSAVLTTTPVYEAFYAEYNAGKAFLHSHSYTGNPLACRAA 349 Query: 296 VASLRAMKREGLAEQAREKGAYMMDKLRAI-QSPKIREVRGLGLMIGVEL---KEKSAP- 350 +A+L + E + E+ RE A++ +L + + P++ +VR G++ VEL K AP Sbjct: 350 LATLDIFRDEPVLERNRELAAHLARRLAPLREHPQVADVRQTGMIAAVELVRDKATRAPY 409 Query: 351 ----------YIHAMEHDEGVLCLAATPLVVRFLPPAVISKEQIDQVV----AAFERVL 395 Y+H +EH G L L VV F+PP V+S +++D +V A ER + Sbjct: 410 PSEERRGLRVYLHGLEH--GAL-LRPLGNVVYFMPPYVVSTDELDHLVDVAIAGIERAI 465 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 467 Length adjustment: 33 Effective length of query: 396 Effective length of database: 434 Effective search space: 171864 Effective search space used: 171864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory