Align kynurenine-oxoglutarate transaminase (EC 2.6.1.7) (characterized)
to candidate N515DRAFT_1410 N515DRAFT_1410 methionine aminotransferase
Query= BRENDA::Q71RI9 (455 letters) >lcl|FitnessBrowser__Dyella79:N515DRAFT_1410 N515DRAFT_1410 methionine aminotransferase Length = 381 Score = 223 bits (569), Expect = 6e-63 Identities = 136/401 (33%), Positives = 211/401 (52%), Gaps = 30/401 (7%) Query: 45 RIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGH 104 ++ + + ++ ++LA + VNLGQGFPD PP ++E +++A + NQY G G Sbjct: 6 KLPKVGTTIFSVMSQLAVEHQAVNLGQGFPDFEPPQALREAIARA-MAEGRNQYAPGIGL 64 Query: 105 PALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYE 164 P L + ++ ++Y R+ID E+ V GA +LF +I +V GDEVI+ P YD YE Sbjct: 65 PTLREQIALKTERMYGRRIDAAGEVTVTSGATEALFAAIAAVVRAGDEVIVFDPAYDSYE 124 Query: 165 PMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKV 224 P++ + GA V IPL + P+ G+ W + + + +T+ I++N+PHNP G V Sbjct: 125 PVIELQGAKAVHIPL-TVPSFGVDW---------QRVRDAVTPRTRMILINSPHNPSGAV 174 Query: 225 YTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFS 284 + +L +A + + + +SDEVYE +V+ G H + + R+I + S GKT+ Sbjct: 175 LSAADLDQLAAIVRDTEIVVLSDEVYEHIVFDGALHQSVLRHAELAARSIVVSSFGKTYH 234 Query: 285 VTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLP 344 TGWKLG+++ PA L + V Q + P Q A AE PE Y LP Sbjct: 235 CTGWKLGYAVAPAALSAEFRKVHQYLTFCTFHPAQVAFAEFM------ASTPEHYL-ELP 287 Query: 345 KELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTK 404 + KRDR L+ K + GGYF + D S++ DEP D F +W+ K Sbjct: 288 AFYQAKRDRFRALIAPSRFKLLDVPGGYFQLVDYSAI--------RDEP-DVTFCEWLVK 338 Query: 405 HKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEE 445 + AIP++ F ++ +LVR CF K D+T+DAA E Sbjct: 339 QGGVAAIPLAPFYETAPD---TRLVRLCFAKSDATMDAAAE 376 Lambda K H 0.320 0.136 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 381 Length adjustment: 31 Effective length of query: 424 Effective length of database: 350 Effective search space: 148400 Effective search space used: 148400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory