Align L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate N515DRAFT_2885 N515DRAFT_2885 homoserine O-acetyltransferase
Query= SwissProt::D2Z028 (374 letters) >FitnessBrowser__Dyella79:N515DRAFT_2885 Length = 368 Score = 452 bits (1163), Expect = e-132 Identities = 225/363 (61%), Positives = 270/363 (74%), Gaps = 2/363 (0%) Query: 8 ASRFIELPDGFAMRRGGALYGARIAYETFGSLNAARDNAVLVLTGLSPDAHAASRPDDPT 67 A R+ LP F M+RGG L+GAR+A+ET+G+L+ ARDNA+L+LTGLSP AHAAS DP+ Sbjct: 5 ARRYFSLPSPFPMKRGGELHGARVAFETWGALSDARDNALLILTGLSPSAHAASNEQDPS 64 Query: 68 PGWWEAMVGPGKPVDTDLWHVICVNSLGSCKGSTGPASTDPRTGEPYRLSFPELSIEDIA 127 PGWWEAM+GPGK +DTD W VICVNSLGS KGST PAS DP TGEPYRLSFPEL++ED+A Sbjct: 65 PGWWEAMIGPGKAIDTDRWFVICVNSLGSDKGSTCPASIDPATGEPYRLSFPELALEDVA 124 Query: 128 DAAAHTVRALGISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALPFSIAVRS 187 +AA V +LGI +LAC+VG SMGGMSALA + HP RTHIS+ A A PF+IA+RS Sbjct: 125 NAAHAAVSSLGIEQLACLVGCSMGGMSALAYMLLHPGSVRTHISVDTAPQAQPFAIAIRS 184 Query: 188 LQREAIRSDPGWLQGHYDEGEGPRRGMLTARKLGMMTYRSAQEWDCRFGRTRIGERRRAD 247 LQREAIR DP W G YD+ P GM ARKLG++TYRSA EW+ RF R R+ +R D Sbjct: 185 LQREAIRLDPQWNNGRYDDAHYPETGMSIARKLGVITYRSAMEWNGRFARIRLDAEQRDD 244 Query: 248 QGRFGPEFEVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGGGGGAPGALSRMR 307 FG EF+VESYL+ HAQRF FDPNSYLYLS A D FD+ + G G L R+R Sbjct: 245 DVPFGFEFQVESYLEGHAQRFVRTFDPNSYLYLSRASDWFDISE--YGEGSIQAGLKRIR 302 Query: 308 VERALVMGARTDILFPLSQQQEIADGLSAGGADVSFLPVDTPAGHDAFLVDIERFGPPVA 367 VE+ALV+G TDILFPL QQ++IA+GL A GA V F+ +D+P GHDAFLVDIE + + Sbjct: 303 VEQALVIGVSTDILFPLEQQEQIAEGLEAAGAAVEFVALDSPQGHDAFLVDIENYSRAIG 362 Query: 368 KFL 370 FL Sbjct: 363 GFL 365 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 368 Length adjustment: 30 Effective length of query: 344 Effective length of database: 338 Effective search space: 116272 Effective search space used: 116272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_2885 N515DRAFT_2885 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.4690.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-113 365.1 0.0 2.3e-113 364.8 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 N515DRAFT_2885 homoserine O-acet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 N515DRAFT_2885 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 364.8 0.0 2.3e-113 2.3e-113 4 350 .. 14 365 .. 12 366 .. 0.96 Alignments for each domain: == domain 1 score: 364.8 bits; conditional E-value: 2.3e-113 TIGR01392 4 eltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedkGWWdellGpgrald 69 ++ ++ G++l+ ++va++t+G l+++rdNa+l++ l+ sah+a++ ++ ++GWW+ ++Gpg+a+d lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 14 PFPMKRGGELHGARVAFETWGALSDARDNALLILTGLSPSAHAASNEQDPSPGWWEAMIGPGKAID 79 78999***************************************88887888************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGg 135 t+r+fv+c+N+lGs kGst P+si+p+tg+py+ +fP ++++D ++a +a + sLg+e+la+ vG lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 80 TDRWFVICVNSLGSDKGSTCPASIDPATGEPYRLSFPELALEDVANAAHAAVSSLGIEQLACLVGC 145 ****************************************************************** PP TIGR01392 136 SlGGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGL 201 S+GGm+al + l p +v++ + + t+++a++ aia++++qr+ai+ Dp++n+G+y++ + Pe+G+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 146 SMGGMSALAYMLLHPGSVRTHISVDTAPQAQPFAIAIRSLQREAIRLDPQWNNGRYDDAHYPETGM 211 ****************************************************************** PP TIGR01392 202 alARmlalltYrseesleerfgreakseeslassl..eeefsvesylryqgkkfverFdAnsYlll 265 ++AR+l+ +tYrs + + rf+r + ++e+ + + ef+vesyl+ ++++fv+ Fd nsYl+l lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 212 SIARKLGVITYRSAMEWNGRFARIRLDAEQRDDDVpfGFEFQVESYLEGHAQRFVRTFDPNSYLYL 277 **********************9988877666554449**************************** PP TIGR01392 266 tkaldthdlargrrdslkealkkikap.vlvvgiesDllftleeqeelakalkaakle..yaeies 328 ++a d +d+++ ++s+++ lk+i+++ +lv+g+++D+lf+le+qe++a+ l+aa+++ ++ ++s lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 278 SRASDWFDISEYGEGSIQAGLKRIRVEqALVIGVSTDILFPLEQQEQIAEGLEAAGAAveFVALDS 343 ***********99************98699************************998888****** PP TIGR01392 329 eeGHDaFllekekveelirefl 350 ++GHDaFl++ e+++++i fl lcl|FitnessBrowser__Dyella79:N515DRAFT_2885 344 PQGHDAFLVDIENYSRAIGGFL 365 *****************99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory