Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate N515DRAFT_3307 N515DRAFT_3307 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::Q9FNK4 (475 letters) >FitnessBrowser__Dyella79:N515DRAFT_3307 Length = 426 Score = 142 bits (357), Expect = 3e-38 Identities = 101/310 (32%), Positives = 152/310 (49%), Gaps = 31/310 (10%) Query: 59 PVVFSRANGSTIWDPEGKRYIDFLAAYSAVNQGHCHPKIMKALQEQVEKLTLSSRAFYND 118 P +RA+G+ +WD EGKRYID++ ++ + GH HP++ +A++ V+ + Sbjct: 32 PFFTARADGAYLWDVEGKRYIDYVGSWGPMIVGHNHPRVREAVERAVK-----DGLSFGT 86 Query: 119 KFPV---FAERLTNMF-GYDMVLPMNTGAEGVETALKLARKWGHEKKNIPKDEAIIVSCC 174 P AE +T + DMV +N+G E +A++LAR K IV Sbjct: 87 PCPAEITMAETITRLVPSVDMVRMVNSGTEATMSAIRLARGATGRSK--------IVKFE 138 Query: 175 GCFHGRTLAIVSMSCDNDATRGFGPLLPG--------NLKVDFGDADSLEKIFKEKGDRI 226 GC+HG + + + T G P PG L + + D + E +F E G I Sbjct: 139 GCYHGHGDSFLVKAGSGALTFGV-PTSPGVPKAAADLTLTLAYNDLAAAEALFAEHGADI 197 Query: 227 AGFLFEPIQGEAGVIIPPDGYLKAVRELCTKYNVLMIADEVQSGLARSGKMLACDWEEIR 286 AG + EP+ G I P DGYL+ +R LCT++ L+I DEV +G R A I Sbjct: 198 AGLIIEPVAGNMNCIPPKDGYLQGLRALCTRHGALLIFDEVMTGF-RVALGGAQAHYGIT 256 Query: 287 PDMVILGKALGGGVIPVSAVLADKDVMLHIKPG---QHGSTFGGNPLASAVAMASLDVIV 343 PD+ GK +GGG +PV A +++M I P T GNP+A A +A L++I Sbjct: 257 PDLSTFGKIIGGG-MPVGAYGGRRELMEQIAPAGPIYQAGTLSGNPVAMAAGLAMLELIQ 315 Query: 344 EEKLVERSAS 353 E +R A+ Sbjct: 316 EAGFYDRLAA 325 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 426 Length adjustment: 33 Effective length of query: 442 Effective length of database: 393 Effective search space: 173706 Effective search space used: 173706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory