GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Dyella japonica UNC79MFTsu3.2

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate N515DRAFT_3768 N515DRAFT_3768 N-acetylglutamate kinase

Query= BRENDA::A0A0H2X8L7
         (447 letters)



>FitnessBrowser__Dyella79:N515DRAFT_3768
          Length = 438

 Score =  686 bits (1770), Expect = 0.0
 Identities = 347/441 (78%), Positives = 382/441 (86%), Gaps = 5/441 (1%)

Query: 6   QPHKQTRQTIVRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDLEALTSSLS 65
           + HK TR+TIVRLLSSM SAKEI QYLKRFSQLDAKRFAVVKVGGAVLRDDL ALTSSL+
Sbjct: 2   EAHKHTRKTIVRLLSSMGSAKEIQQYLKRFSQLDAKRFAVVKVGGAVLRDDLPALTSSLT 61

Query: 66  FLQEVGLTPIVLHGAGPQLDAELSAAGIEKQTVNGLRVTSPHALAIVRKVFQASNLKLVE 125
           FLQ+VGLTPIVLHGAGPQLD ELSAAGI+KQTVNGLRVTSP ALAIVRKVFQ  NL+LVE
Sbjct: 62  FLQQVGLTPIVLHGAGPQLDEELSAAGIQKQTVNGLRVTSPKALAIVRKVFQEQNLRLVE 121

Query: 126 ALQQNGARATSITGGVFEAEYLNRDTYGLVGEVKAVNLAPIEASLQAGSIPVITSLGETP 185
           ALQ    RATS+  GVF +EYL+RD YGLVG+V ++NLAPIEASL+AGSIPVI SLGET 
Sbjct: 122 ALQGMDTRATSVPSGVFTSEYLDRDVYGLVGKVSSINLAPIEASLRAGSIPVIASLGETA 181

Query: 186 SGQILNVNADFAANELVQELQPYKIIFLTGTGGLLDAEGKLIDSINLSTEYDHLMQQPWI 245
            GQILN+NADFAANELV+ LQPYKI+FLTGTGGLLD +G++IDSINLSTEY+HLM QPWI
Sbjct: 182 EGQILNINADFAANELVRVLQPYKIVFLTGTGGLLDDKGRIIDSINLSTEYEHLMAQPWI 241

Query: 246 NGGMRVKIEQIKDLLDRLPLESSVSITRPADLAKELFTHKGSGTLVRRGERVLRATSWDE 305
           NGGMRVKIEQI DLL  LPL SSVSIT+P++LAKELFTHKGSGTLVRRGE+VLR  SW+ 
Sbjct: 242 NGGMRVKIEQIADLLSSLPLTSSVSITQPSELAKELFTHKGSGTLVRRGEKVLRYESWEG 301

Query: 306 LDLPRLTSLIESSFGRTLVPDYFSNTKLLRAYVSENYRAAVILTDEGMLGASALIYLDKF 365
           +DL R+  LIESSFGR +V DYF  T+  R YVSENYRAA+ILT E       L YLDKF
Sbjct: 302 IDLARMRELIESSFGRKVVADYFERTRPYRIYVSENYRAAMILTQE-----EGLAYLDKF 356

Query: 366 AVLDDAQGEGLGRAVWNVMREETPQLFWRSRHNNQVNIFYYAESDGCIKQEKWKVFWYGL 425
           AVLDDAQGEGLGRAVW VMREE PQLFWRSRH NQVNIFYYAESDGC KQE+WKVFWYGL
Sbjct: 357 AVLDDAQGEGLGRAVWQVMREENPQLFWRSRHGNQVNIFYYAESDGCFKQERWKVFWYGL 416

Query: 426 ENFEQIQHCVAHCATRQPTLL 446
           +NF +I+ CVAHCA R  TL+
Sbjct: 417 KNFGEIERCVAHCAVRPATLM 437


Lambda     K      H
   0.318    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 655
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 447
Length of database: 438
Length adjustment: 32
Effective length of query: 415
Effective length of database: 406
Effective search space:   168490
Effective search space used:   168490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate N515DRAFT_3768 N515DRAFT_3768 (N-acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.12630.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.12630.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.