GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argB in Dyella japonica UNC79MFTsu3.2

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate N515DRAFT_3768 N515DRAFT_3768 N-acetylglutamate kinase

Query= BRENDA::A0A0H2X8L7
         (447 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3768 N515DRAFT_3768
           N-acetylglutamate kinase
          Length = 438

 Score =  686 bits (1770), Expect = 0.0
 Identities = 347/441 (78%), Positives = 382/441 (86%), Gaps = 5/441 (1%)

Query: 6   QPHKQTRQTIVRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDLEALTSSLS 65
           + HK TR+TIVRLLSSM SAKEI QYLKRFSQLDAKRFAVVKVGGAVLRDDL ALTSSL+
Sbjct: 2   EAHKHTRKTIVRLLSSMGSAKEIQQYLKRFSQLDAKRFAVVKVGGAVLRDDLPALTSSLT 61

Query: 66  FLQEVGLTPIVLHGAGPQLDAELSAAGIEKQTVNGLRVTSPHALAIVRKVFQASNLKLVE 125
           FLQ+VGLTPIVLHGAGPQLD ELSAAGI+KQTVNGLRVTSP ALAIVRKVFQ  NL+LVE
Sbjct: 62  FLQQVGLTPIVLHGAGPQLDEELSAAGIQKQTVNGLRVTSPKALAIVRKVFQEQNLRLVE 121

Query: 126 ALQQNGARATSITGGVFEAEYLNRDTYGLVGEVKAVNLAPIEASLQAGSIPVITSLGETP 185
           ALQ    RATS+  GVF +EYL+RD YGLVG+V ++NLAPIEASL+AGSIPVI SLGET 
Sbjct: 122 ALQGMDTRATSVPSGVFTSEYLDRDVYGLVGKVSSINLAPIEASLRAGSIPVIASLGETA 181

Query: 186 SGQILNVNADFAANELVQELQPYKIIFLTGTGGLLDAEGKLIDSINLSTEYDHLMQQPWI 245
            GQILN+NADFAANELV+ LQPYKI+FLTGTGGLLD +G++IDSINLSTEY+HLM QPWI
Sbjct: 182 EGQILNINADFAANELVRVLQPYKIVFLTGTGGLLDDKGRIIDSINLSTEYEHLMAQPWI 241

Query: 246 NGGMRVKIEQIKDLLDRLPLESSVSITRPADLAKELFTHKGSGTLVRRGERVLRATSWDE 305
           NGGMRVKIEQI DLL  LPL SSVSIT+P++LAKELFTHKGSGTLVRRGE+VLR  SW+ 
Sbjct: 242 NGGMRVKIEQIADLLSSLPLTSSVSITQPSELAKELFTHKGSGTLVRRGEKVLRYESWEG 301

Query: 306 LDLPRLTSLIESSFGRTLVPDYFSNTKLLRAYVSENYRAAVILTDEGMLGASALIYLDKF 365
           +DL R+  LIESSFGR +V DYF  T+  R YVSENYRAA+ILT E       L YLDKF
Sbjct: 302 IDLARMRELIESSFGRKVVADYFERTRPYRIYVSENYRAAMILTQE-----EGLAYLDKF 356

Query: 366 AVLDDAQGEGLGRAVWNVMREETPQLFWRSRHNNQVNIFYYAESDGCIKQEKWKVFWYGL 425
           AVLDDAQGEGLGRAVW VMREE PQLFWRSRH NQVNIFYYAESDGC KQE+WKVFWYGL
Sbjct: 357 AVLDDAQGEGLGRAVWQVMREENPQLFWRSRHGNQVNIFYYAESDGCFKQERWKVFWYGL 416

Query: 426 ENFEQIQHCVAHCATRQPTLL 446
           +NF +I+ CVAHCA R  TL+
Sbjct: 417 KNFGEIERCVAHCAVRPATLM 437


Lambda     K      H
   0.318    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 655
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 447
Length of database: 438
Length adjustment: 32
Effective length of query: 415
Effective length of database: 406
Effective search space:   168490
Effective search space used:   168490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate N515DRAFT_3768 N515DRAFT_3768 (N-acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00761.hmm
# target sequence database:        /tmp/gapView.12129.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00761  [M=231]
Accession:   TIGR00761
Description: argB: acetylglutamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    1.4e-60  190.8   0.0    1.8e-60  190.3   0.0    1.1  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_3768  N515DRAFT_3768 N-acetylglutamate


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_3768  N515DRAFT_3768 N-acetylglutamate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  190.3   0.0   1.8e-60   1.8e-60       1     225 [.      39     259 ..      39     266 .. 0.97

  Alignments for each domain:
  == domain 1  score: 190.3 bits;  conditional E-value: 1.8e-60
                                    TIGR00761   1 tiViKiGGaaiselleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdket 66 
                                                  ++V+K+GGa++++ l +l + + +l+++g+ ++++HG gp+ +e l++ gi+ ++vnglRvT  ++
  lcl|FitnessBrowser__Dyella79:N515DRAFT_3768  39 FAVVKVGGAVLRDDLPALTSSLTFLQQVGLTPIVLHGAGPQLDEELSAAGIQKQTVNGLRVTSPKA 104
                                                  58**************************************************************** PP

                                    TIGR00761  67 levvemvligkvnkelvallekhgikavGltgkDgqlltaekldkedlgyvGeikkvnkelleall 132
                                                  l++v++v+ + +n +lv++l+  + +a  + ++   ++t e+ld++ +g+vG+++++n + +ea+l
  lcl|FitnessBrowser__Dyella79:N515DRAFT_3768 105 LAIVRKVFQE-QNLRLVEALQGMDTRATSVPSG---VFTSEYLDRDVYGLVGKVSSINLAPIEASL 166
                                                  ********99.9****************99999...****************************** PP

                                    TIGR00761 133 kagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliselel.ee 197
                                                   ag ipviasl+ ++egq+lN+naD aA el ++l++ k+v+Lt + G+l++ k ++i++++l  e
  lcl|FitnessBrowser__Dyella79:N515DRAFT_3768 167 RAGSIPVIASLGETAEGQILNINADFAANELVRVLQPYKIVFLTGTGGLLDD-KGRIIDSINLsTE 231
                                                  ***************************************************9.666*******889 PP

                                    TIGR00761 198 ieqlikqavikgGmipKveaalealesg 225
                                                  +e+l+ q +i+gGm  K+e++++ l+s+
  lcl|FitnessBrowser__Dyella79:N515DRAFT_3768 232 YEHLMAQPWINGGMRVKIEQIADLLSSL 259
                                                  **********************999876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (231 nodes)
Target sequences:                          1  (438 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 13.83
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory