Align Phosphoserine phosphatase RsbU; EC 3.1.3.3; Sigma factor SigB regulation protein RsbU (uncharacterized)
to candidate N515DRAFT_0975 N515DRAFT_0975 sigma-B regulation protein RsbU (phosphoserine phosphatase)
Query= curated2:P40399 (335 letters) >FitnessBrowser__Dyella79:N515DRAFT_0975 Length = 768 Score = 89.4 bits (220), Expect = 3e-22 Identities = 60/193 (31%), Positives = 96/193 (49%), Gaps = 13/193 (6%) Query: 94 QQEIKSEIEIAANVQQTLLGTKVPQEEALD-------IGAISVPAKQMSGDYY-HFVKDK 145 QQ + SE+EIA +Q LL P LD + A+ PA+ + GD Y +F+ Sbjct: 377 QQRLASELEIAQQIQTALL----PGAHFLDARCNNFELHAVLKPARTVGGDLYSYFMLHD 432 Query: 146 ESINIAIADVIGKGIPAALCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNVDASMFIT 205 + I + DV KGIPAAL M+ +L P Q+L+ LN+ + +N D MF++ Sbjct: 433 QRFYIMVGDVSDKGIPAALFMARAITLAKALAPRAQSPQQLLQLLNQELCRNNDGCMFVS 492 Query: 206 MFYANYNMDKHQFTYASAGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYKQFDQHLEK 265 + + F+ ASAGHEP + + ++E G LG+ + Y L Sbjct: 493 LLCGLLDTATGHFSMASAGHEPPVLWGEGAPQLLEIET-GPALGLDDEATYSSRRVRLRP 551 Query: 266 GDMIVLFSDGVTE 278 G+ +++++DG+TE Sbjct: 552 GETLLMYTDGITE 564 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 768 Length adjustment: 34 Effective length of query: 301 Effective length of database: 734 Effective search space: 220934 Effective search space used: 220934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory