GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Dyella japonica UNC79MFTsu3.2

Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate N515DRAFT_0109 N515DRAFT_0109 aspartate-semialdehyde dehydrogenase

Query= SwissProt::P23247
         (337 letters)



>FitnessBrowser__Dyella79:N515DRAFT_0109
          Length = 342

 Score =  407 bits (1047), Expect = e-118
 Identities = 210/335 (62%), Positives = 251/335 (74%), Gaps = 3/335 (0%)

Query: 5   FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDW 64
           + VA+ GATGAVGET+L +L ER+FPV EL  LASERS G    F GK+V V+N+ ++D+
Sbjct: 7   YKVAMVGATGAVGETLLAILAERKFPVGELVPLASERSAGGKVDFAGKSVTVRNLADYDF 66

Query: 65  SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNR 124
           + V IA FSAGG +S + AP AA AG VVIDNTS FRY  DIPLVV EVNP AIA +  R
Sbjct: 67  TGVDIAFFSAGGSVSREHAPRAAAAGAVVIDNTSEFRYQDDIPLVVSEVNPHAIARYTVR 126

Query: 125 NIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYP 184
            IIANPNCST+QMLVAL PI+   GIERINV TYQSVSGAG++G++EL  QTA LLN   
Sbjct: 127 GIIANPNCSTMQMLVALAPIHRQAGIERINVATYQSVSGAGRSGMEELGKQTAALLNFQD 186

Query: 185 AETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYG 244
            E + F +QIAFN IP ID F DNGYTKEEMKMVWET+KI  D +I VNPT VRVPVFYG
Sbjct: 187 VERSKFPKQIAFNVIPHIDDFQDNGYTKEEMKMVWETRKILEDETIQVNPTAVRVPVFYG 246

Query: 245 HAEAVHVETRAPIDAEQVMDMLEQTDGI---ELFRGADFPTQVRDAGGKDHVLVGRVRND 301
           H+EAVH+ETR  I A Q   +LE+ +G+   +  +   +PT V DA GKD V VGR+R D
Sbjct: 247 HSEAVHIETRDKITAGQARALLEKAEGVVVQDERKAGGYPTPVGDAAGKDPVFVGRIRED 306

Query: 302 ISHHSGINLWVVADNVRKGAATNAVQIAELLVRDY 336
           ISH  G++LW+V+DN+RKGAA NAVQIAE L+ DY
Sbjct: 307 ISHERGLDLWIVSDNIRKGAALNAVQIAERLIEDY 341


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 372
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 342
Length adjustment: 28
Effective length of query: 309
Effective length of database: 314
Effective search space:    97026
Effective search space used:    97026
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate N515DRAFT_0109 N515DRAFT_0109 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.27321.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.27321.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.