Align Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate N515DRAFT_2933 N515DRAFT_2933 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= curated2:P9WMM4 (244 letters) >FitnessBrowser__Dyella79:N515DRAFT_2933 Length = 242 Score = 134 bits (336), Expect = 2e-36 Identities = 91/246 (36%), Positives = 131/246 (53%), Gaps = 11/246 (4%) Query: 1 MPLILLPAVDVVEGRAVRLVQGKAGSQTEYG-SAVDAALGWQRDGAEWIHLVDLDAAFGR 59 M ++PA+D+ GR VRL QG G QT Y + A + GA W+H+VDLD A Sbjct: 1 MSFTVIPAIDLRTGRVVRLRQGDYGQQTTYEFEPRELARRYAEAGAAWLHVVDLDGARSG 60 Query: 60 GSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGE 119 ++ + E + + +QV+ GG+R + L G ARV VG+ A+ P +G+ Sbjct: 61 SLDNLQVIEALARDGMQVQAGGGVRSEADLQRLFDAGVARVVVGSVAIREPALVGAWLGK 120 Query: 120 HG-DQVAVGLDVQIIDGEHRLRGRGW-ETDGGDLWDVLERLDSEGCSRFVVTDITKDGTL 177 G D++ V LD + IDG L GW E + L ++ + G + TDI +DG L Sbjct: 121 FGTDKLTVALDTRRIDGRWALPSAGWTELEARSLDELAPWYAARGARHLLCTDIDRDGML 180 Query: 178 GGPNLDLLAGVADRTDAPVI---ASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFT 234 G NL+L +A RT AP + ASGGV S+DD+ A G +G I+G+AL RFT Sbjct: 181 AGFNLELYRDLA-RT-APTLAVQASGGVRSVDDIVAARA---AGAQGVILGRALLEGRFT 235 Query: 235 LPQALA 240 + +ALA Sbjct: 236 IEEALA 241 Lambda K H 0.318 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 242 Length adjustment: 23 Effective length of query: 221 Effective length of database: 219 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory