Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate N515DRAFT_2113 N515DRAFT_2113 anthranilate synthase component 2
Query= BRENDA::P20576 (201 letters) >FitnessBrowser__Dyella79:N515DRAFT_2113 Length = 198 Score = 289 bits (740), Expect = 2e-83 Identities = 135/190 (71%), Positives = 163/190 (85%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 MLLMIDNYDSFT+NLVQY GEL EVKVVRND L V I AL P I++SPGP TP++AG Sbjct: 1 MLLMIDNYDSFTFNLVQYLGELGQEVKVVRNDALDVAGIRALRPSHIMISPGPGTPDDAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 VSL V+ + +G++P+ GVCLGHQ+IGQAFGG+V+RA+Q+MHGKTSP+ H+ GVFAGL + Sbjct: 61 VSLDVLRQLSGEVPVFGVCLGHQAIGQAFGGKVIRAKQIMHGKTSPVRHRGRGVFAGLPD 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 P TRYHSLVV++ SLP+CLEVTAWT+HADGS+DEIMG+RHKTL +EGVQFHPESILT+ Sbjct: 121 PFEATRYHSLVVEQGSLPDCLEVTAWTEHADGSIDEIMGLRHKTLPIEGVQFHPESILTQ 180 Query: 181 QGHELLANFL 190 GH+LL NFL Sbjct: 181 HGHDLLRNFL 190 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 198 Length adjustment: 21 Effective length of query: 180 Effective length of database: 177 Effective search space: 31860 Effective search space used: 31860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate N515DRAFT_2113 N515DRAFT_2113 (anthranilate synthase component 2)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.695.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-84 267.4 0.0 3.9e-84 267.3 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2113 N515DRAFT_2113 anthranilate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2113 N515DRAFT_2113 anthranilate synthase component 2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 267.3 0.0 3.9e-84 3.9e-84 1 190 [. 1 190 [. 1 192 [. 0.98 Alignments for each domain: == domain 1 score: 267.3 bits; conditional E-value: 3.9e-84 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaissle 66 m+l+idnydsft+nlvq+l elg+ev v rnd+l ++ i al p + i+isPGP+tPd+a++s l+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2113 1 MLLMIDNYDSFTFNLVQYLGELGQEVKVVRNDALDVAGIRALRPSH-IMISPGPGTPDDAGVS-LD 64 79********************************************.****************.** PP TIGR00566 67 liehlaGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryh 132 ++++l+G +P++GvClGhqa++qafG++v+ra++++hGk+s ++h g++vfagl +P ++atryh lcl|FitnessBrowser__Dyella79:N515DRAFT_2113 65 VLRQLSGEVPVFGVCLGHQAIGQAFGGKVIRAKQIMHGKTSPVRHRGRGVFAGLPDP--FEATRYH 128 *********************************************************..******* PP TIGR00566 133 slvveaetldtllevtaleeee....ieimairhrdlpleGvqfhPesilselGkellanfl 190 slvve +l+++levta++e+ +eim++rh+ lp+eGvqfhPesil+++G+ ll+nfl lcl|FitnessBrowser__Dyella79:N515DRAFT_2113 129 SLVVEQGSLPDCLEVTAWTEHAdgsiDEIMGLRHKTLPIEGVQFHPESILTQHGHDLLRNFL 190 ******************998778889**********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (198 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory