Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate N515DRAFT_2112 N515DRAFT_2112 anthranilate phosphoribosyltransferase (EC 2.4.2.18)
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__Dyella79:N515DRAFT_2112 Length = 351 Score = 491 bits (1264), Expect = e-143 Identities = 254/342 (74%), Positives = 289/342 (84%), Gaps = 1/342 (0%) Query: 3 ITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAAT 62 ITPQ+ALQRTIEHREIFHDEM++LMRQIMRGEVS M +AI+TGLRVKKETIGEI GAA Sbjct: 10 ITPQEALQRTIEHREIFHDEMIELMRQIMRGEVSPLMTAAIITGLRVKKETIGEITGAAR 69 Query: 63 VMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKS 122 VMRE + +VE H VDIVGTGGDG+ +FNIST +MFVAAA GA+VAKHG RSVSSKS Sbjct: 70 VMRELAEKVEAAPHAHFVDIVGTGGDGASSFNISTASMFVAAAAGARVAKHGGRSVSSKS 129 Query: 123 GSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNIL 182 GSAD LEALGA I+L P +VA + +T IGFM+AP HHPAMKVVAPVR+EMGVRT+FNIL Sbjct: 130 GSADVLEALGASIDLAPARVAQCMDETDIGFMFAPNHHPAMKVVAPVRKEMGVRTLFNIL 189 Query: 183 GPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGEL 242 GPLTNPAG+PNILMGVFHPDLVGIQ RVLQ+LGA ALVVWGRDGMDE+SLGA TLVGEL Sbjct: 190 GPLTNPAGAPNILMGVFHPDLVGIQVRVLQQLGARHALVVWGRDGMDEISLGASTLVGEL 249 Query: 243 RDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGAAL 302 RDG+V EYEV PEDFG+AM++SRNL+V +AAESRAMLL+ L+ G DIV LNAGAAL Sbjct: 250 RDGEVREYEVEPEDFGLAMASSRNLRVENAAESRAMLLEALEGRRGVPHDIVCLNAGAAL 309 Query: 303 YVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQ-ATA 343 Y A VA SIA GI AR +A G+ARA +DA+VA T++ ATA Sbjct: 310 YAADVAPSIAAGIELARATIASGAARAKMDAFVATTRRLATA 351 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 351 Length adjustment: 29 Effective length of query: 316 Effective length of database: 322 Effective search space: 101752 Effective search space used: 101752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_2112 N515DRAFT_2112 (anthranilate phosphoribosyltransferase (EC 2.4.2.18))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.16635.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-129 416.0 1.6 6.9e-129 415.8 1.6 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 N515DRAFT_2112 anthranilate phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 N515DRAFT_2112 anthranilate phosphoribosyltransferase (EC 2.4.2.18) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 415.8 1.6 6.9e-129 6.9e-129 1 329 [. 16 343 .. 16 344 .. 0.99 Alignments for each domain: == domain 1 score: 415.8 bits; conditional E-value: 6.9e-129 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke 66 l++ ++++++ ++e+ +lm++im+ge+s+ aAi++ lrvk et+ ei+g+a+++re a+kve+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 16 LQRTIEHREIFHDEMIELMRQIMRGEVSPLMTAAIITGLRVKKETIGEITGAARVMRELAEKVEAA 81 578999************************************************************ PP TIGR01245 67 eseelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspe 132 +++++vDivGTGGDg++++NiSTas++vaaaaG++vaKhG rsvssksGsaDvLealg++++l p+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 82 PHAHFVDIVGTGGDGASSFNISTASMFVAAAAGARVAKHGGRSVSSKSGSADVLEALGASIDLAPA 147 ****************************************************************** PP TIGR01245 133 kvarsleevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvev 198 +va++++e++igF+fAP++hpa+k vapvRke+gvrt+fN+LGPL+nPa a++ ++Gv+++dlv + lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 148 RVAQCMDETDIGFMFAPNHHPAMKVVAPVRKEMGVRTLFNILGPLTNPAGAPNILMGVFHPDLVGI 213 ****************************************************************** PP TIGR01245 199 laevlknlgvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsa 264 ++vl++lg+++alvv g+dg+DEisl ++t v el+dge++ey+++pedfgl++a+ ++l++++a lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 214 QVRVLQQLGARHALVVWGRDGMDEISLGASTLVGELRDGEVREYEVEPEDFGLAMASSRNLRVENA 279 ****************************************************************** PP TIGR01245 265 eenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 +e+ ++l e+leg+ + +div lNa+aaly+a++a ++++g+ela+++i sg+a +k++++va lcl|FitnessBrowser__Dyella79:N515DRAFT_2112 280 AESRAMLLEALEGRR-GVPHDIVCLNAGAALYAADVAPSIAAGIELARATIASGAARAKMDAFVA 343 **************9.6669***************************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.00 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory