Align Anthranilate synthase component 1 2; EC 4.1.3.27; Anthranilate synthase component I 2 (uncharacterized)
to candidate N515DRAFT_2823 N515DRAFT_2823 anthranilate synthase component 1
Query= curated2:Q9HS66 (488 letters) >FitnessBrowser__Dyella79:N515DRAFT_2823 Length = 449 Score = 236 bits (602), Expect = 1e-66 Identities = 175/410 (42%), Positives = 219/410 (53%), Gaps = 47/410 (11%) Query: 80 GALDTVQAAVGA-RLARVGCD-VPHPGGLFGWLSYDIARELEAIPDTTTDARGLPRLQLG 137 G L + AA A RL R D +P GG +L+Y++A E+E PRL+L Sbjct: 71 GFLHALDAAWQAERLPRDADDGLPFHGGWVLFLAYELAGEIE------------PRLRLA 118 Query: 138 ---VYPTIAAWREPFTPGDDLRLIAAVPVD---EYTPDGAFEAGRDRVQSLAAAIRDGDP 191 V P A R P AA VD E T A D ++ +AA D Sbjct: 119 PHEVLPVALALRCP----------AAAIVDHERERTVLIAEPGCEDLLEQMAA-----DL 163 Query: 192 AVGPPPADSPAPFE-SVAGRAAFESRVRRIQDAIRDGDTFQANVSHR-----LDAPAAVH 245 PP A PAP E F V RI + + GD FQ N+S DAP Sbjct: 164 EAQPPIAPLPAPLERDEDDPQLFRDGVARIHEHLHAGDIFQVNLSRAWRARFADAPT--- 220 Query: 246 PVAVFEALRDTNPAPYSGIVEFPGVDLVSASPELLLARRGRELTTEPIAGTRPRGATPAE 305 P +++ +LR NPAP++G+++ P +VS+SPE L+ RG T PIAGTRPR TPA+ Sbjct: 221 PASLYASLRMANPAPFAGLLQQPDWAVVSSSPERLVEARGGVAQTRPIAGTRPR--TPAD 278 Query: 306 DDAARAA-LRADDKERAEHAMLVDLERNDLGKVSEYGSVAVPDYRRVDAYSEVLHLVSEV 364 D+ AR LR KERAEH ML+DLERNDLG+V GSV V + V++Y+ V H+VS V Sbjct: 279 DELARIRELRTHPKERAEHVMLIDLERNDLGRVCVPGSVQVDELMVVESYAHVHHIVSNV 338 Query: 365 TGRLRDSCSLRDAIAAVFPGGTITGAPKPRTMALIDTVEATRRGPYTGSLAAIGFDGDAT 424 G+LR + IAA FPGGTITG PK R M +I +E RG YTG+L + +GD Sbjct: 339 RGKLRPGVTPGQVIAATFPGGTITGCPKVRCMEIIHALEDAPRGAYTGALGYLDRNGDLD 398 Query: 425 LSITIRTLVRRAATYHLRVGAGIVHDSTPAAEYDETLAKARALVTALGDA 474 L+I IRTL LR GAGIV DS E DET AKAR L+ ALG A Sbjct: 399 LNILIRTLTLAGTQVSLRAGAGIVADSVAEKELDETRAKARGLLRALGVA 448 Lambda K H 0.317 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 449 Length adjustment: 33 Effective length of query: 455 Effective length of database: 416 Effective search space: 189280 Effective search space used: 189280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory