GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cmutase in Dyella japonica UNC79MFTsu3.2

Align Salicylate synthase; Chorismate mutase; CM; Isochorismate synthase/isochorismate lyase; Mycobactin synthase protein; EC 5.4.99.5; EC 4.2.99.21; EC 5.4.4.2 (characterized)
to candidate N515DRAFT_2823 N515DRAFT_2823 anthranilate synthase component 1

Query= SwissProt::P9WFX1
         (450 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2823 N515DRAFT_2823
           anthranilate synthase component 1
          Length = 449

 Score =  131 bits (330), Expect = 4e-35
 Identities = 133/422 (31%), Positives = 185/422 (43%), Gaps = 40/422 (9%)

Query: 48  YECDGQWVLAAGVQAMVEL----DSDELRVIRDGVTRRQQWSGRPGA---ALGEA--VDR 98
           Y C  Q V+    QA  +L      D L +  DG     Q +   G    AL  A   +R
Sbjct: 25  YPCLLQSVVRGTPQARFDLLFAFPRDRLTLHADGRVLDGQGAEHAGGFLHALDAAWQAER 84

Query: 99  LLLETDQAF----GWVAFEFGVHRYGL------QQRLAPHTPLARVFS---PRTRIMVSE 145
           L  + D       GWV F      Y L      + RLAPH  L    +   P   I+  E
Sbjct: 85  LPRDADDGLPFHGGWVLFL----AYELAGEIEPRLRLAPHEVLPVALALRCPAAAIVDHE 140

Query: 146 KEIRLFDAGIRHREAIDRLLAT-----GVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAA 200
           +E  +  A     + ++++ A       +  +P     D  DDP  FR  VA   + + A
Sbjct: 141 RERTVLIAEPGCEDLLEQMAADLEAQPPIAPLPAPLERD-EDDPQLFRDGVARIHEHLHA 199

Query: 201 GRYHKVILSRCVEVPFAIDFPLT---YRLGRRHNTPVRSFLLQLGGIRALGYSPELVTAV 257
           G   +V LSR     FA D P     Y   R  N    + LLQ      +  SPE +   
Sbjct: 200 GDIFQVNLSRAWRARFA-DAPTPASLYASLRMANPAPFAGLLQQPDWAVVSSSPERLVEA 258

Query: 258 RADGVVITEPLAGTRALGRGPAIDRLAR-DDLESNSKEIVEHAISVRSSLEEITDIAEPG 316
           R  GV  T P+AGTR   R PA D LAR  +L ++ KE  EH + +     ++  +  PG
Sbjct: 259 RG-GVAQTRPIAGTRP--RTPADDELARIRELRTHPKERAEHVMLIDLERNDLGRVCVPG 315

Query: 317 SAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFR 376
           S  V + M V     V H+ S +R +L P       + A FP  T +G PK   +E I  
Sbjct: 316 SVQVDELMVVESYAHVHHIVSNVRGKLRPGVTPGQVIAATFPGGTITGCPKVRCMEIIHA 375

Query: 377 LDECPRGLYSGAVVMLSADGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETC 436
           L++ PRG Y+GA+  L  +G LD  + +R     G +  LRAGAGI+ +S  E+E +ET 
Sbjct: 376 LEDAPRGAYTGALGYLDRNGDLDLNILIRTLTLAGTQVSLRAGAGIVADSVAEKELDETR 435

Query: 437 EK 438
            K
Sbjct: 436 AK 437


Lambda     K      H
   0.319    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 461
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 450
Length of database: 449
Length adjustment: 33
Effective length of query: 417
Effective length of database: 416
Effective search space:   173472
Effective search space used:   173472
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory