Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate N515DRAFT_0573 N515DRAFT_0573 branched-chain amino acid aminotransferase
Query= CharProtDB::CH_024500 (309 letters) >FitnessBrowser__Dyella79:N515DRAFT_0573 Length = 313 Score = 355 bits (912), Expect = e-103 Identities = 176/301 (58%), Positives = 220/301 (73%), Gaps = 1/301 (0%) Query: 8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKI 67 ++W NG++ W +A VHV +HALHYG+SVFEG R Y + +GP FR +H +RL +SA++ Sbjct: 5 FLWHNGQIKPWTEATVHVSTHALHYGSSVFEGERVYATPQGPAYFRLADHTRRLFESARV 64 Query: 68 YRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPW 127 Y V S DE+ AC +VIR N + SAY+RP++F G G+GV G DV I A W Sbjct: 65 YEIEVGYSEDEINAACMEVIRANRMGSAYVRPIVFRGAGGLGVLAKPGAPVDVAIMAMEW 124 Query: 128 GAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALD 187 GAYLG +A EQG D VSSW R APNT+P+ AKAGGNYLSS L+G EARR GY EGIAL Sbjct: 125 GAYLG-DAREQGADVCVSSWQRPAPNTVPSWAKAGGNYLSSQLIGLEARRGGYAEGIALG 183 Query: 188 VNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESL 247 NG +SEGAGEN+F VK+G L TPP ++ L GITRD ++ LA++LGI+V E+ L RE+L Sbjct: 184 HNGLLSEGAGENVFVVKNGKLLTPPTSAGILAGITRDTVMTLAEDLGIKVEERDLPREAL 243 Query: 248 YLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQV 307 Y ADEVFM+GTAAEITPVRSVD VG GR GP+T+ +Q AFFGLF G T+D+WGWL V Sbjct: 244 YTADEVFMTGTAAEITPVRSVDRKPVGTGRPGPITRALQDAFFGLFDGRTDDRWGWLAPV 303 Query: 308 N 308 + Sbjct: 304 H 304 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 313 Length adjustment: 27 Effective length of query: 282 Effective length of database: 286 Effective search space: 80652 Effective search space used: 80652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory