Align Beta-phenylalanine transaminase; Aromatic beta-amino acid aminotransferase; Beta-phenylalanine aminotransferase; VpAT; EC 2.6.1.- (characterized)
to candidate N515DRAFT_3307 N515DRAFT_3307 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::H8WR05 (434 letters) >FitnessBrowser__Dyella79:N515DRAFT_3307 Length = 426 Score = 221 bits (564), Expect = 3e-62 Identities = 145/404 (35%), Positives = 195/404 (48%), Gaps = 19/404 (4%) Query: 28 FEAQARYMPGANSRSVLFYAPF---PLTIARGEGAALWDADGHRYADFIAEYTAGVYGHS 84 F+ + MPG + V + P AR +GA LWD +G RY D++ + + GH+ Sbjct: 7 FQRAKQLMPGGVNSPVRAFKSVGGEPFFTARADGAYLWDVEGKRYIDYVGSWGPMIVGHN 66 Query: 85 APEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAAL 144 P +R+AV A++ G++ E +A I P ++ +R NSGTEA + A+ A Sbjct: 67 HPRVREAVERAVKDGLSFGTPCPAEITMAETITRLVPSVDMVRMVNSGTEATMSAIRLAR 126 Query: 145 HFTGRRKIVVFSGGYHG-----------GVLGFGARPSP--TTVPFDF-LVLPYNDAQTA 190 TGR KIV F G YHG G L FG SP D L L YND A Sbjct: 127 GATGRSKIVKFEGCYHGHGDSFLVKAGSGALTFGVPTSPGVPKAAADLTLTLAYNDLAAA 186 Query: 191 RAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAP 249 A HG +IA +++EP+ G CIP + +LQ LR T+ GALL+FDEVMT R+A Sbjct: 187 EALFAEHGADIAGLIIEPVAGNMNCIPPKDGYLQGLRALCTRHGALLIFDEVMTGFRVAL 246 Query: 250 HGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRTGPLAHSGTFNNNVMTMA 309 G GI DL+T GK IGGGM GA+GGR ++M P GP+ +GT + N + MA Sbjct: 247 GGAQAHYGITPDLSTFGKIIGGGMPVGAYGGRRELMEQIAP-AGPIYQAGTLSGNPVAMA 305 Query: 310 AGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRS 369 AG A L + LA R L L A+ EGV +G++ F Q V S Sbjct: 306 AGLAMLELIQEAGFYDRLAARTRLLADGLQAVADGEGVPFSTNRVGAMFGLFFTQEKVES 365 Query: 370 SEDLAAVDGRLRQLLFFHLLNEDIYSSPRGFVVLSLPLTDADID 413 A D F +L +Y +P F L +D D Sbjct: 366 YAHATAADTAAFNRFFHGMLERGVYLAPSAFEAGFLSSAHSDED 409 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 426 Length adjustment: 32 Effective length of query: 402 Effective length of database: 394 Effective search space: 158388 Effective search space used: 158388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory