Align succinylornithine transaminase; EC 2.6.1.81 (characterized)
to candidate HSERO_RS16670 HSERO_RS16670 acetylornithine aminotransferase
Query= CharProtDB::CH_002469 (406 letters) >FitnessBrowser__HerbieS:HSERO_RS16670 Length = 400 Score = 291 bits (745), Expect = 2e-83 Identities = 162/362 (44%), Positives = 218/362 (60%), Gaps = 5/362 (1%) Query: 28 GEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLA 87 G G L D GK Y+D+ G AVN LGHA + +AL Q+ K + + NEP + LA Sbjct: 25 GHGMWLTDHNGKRYLDYLQGWAVNTLGHAPQCIADALAAQSKKLINPSPAFYNEPSIELA 84 Query: 88 KKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRY---GSHKSGIVAFKNAFHGRTLF 144 K L + DRVFF NSG EANE A+KLARK+ GS + I+ FK++FHGRTL Sbjct: 85 KLLTANSVFDRVFFANSGGEANEGAIKLARKWGKKNPAADGSARFEIITFKHSFHGRTLA 144 Query: 145 TVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNA 204 T+SA G+ + FAP A ND+ S ALI + T AV++EP+QGEGGV+PAS Sbjct: 145 TMSASGKDGWDTMFAPQVPGFPKAVLNDLESVKALIGEHTVAVMLEPVQGEGGVIPASKE 204 Query: 205 FLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALL 264 F+QGLR L N LLI DEVQ+G+GRTG+L+AY H G+ PD++T AK +GGG P+ ALL Sbjct: 205 FMQGLRSLTKEKNLLLIVDEVQSGMGRTGQLFAYQHSGIEPDIMTLAKGIGGGVPLAALL 264 Query: 265 ATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINH 324 A EE A G G TY GNPL +AV V++ + P + V++R + +R I+ Sbjct: 265 AREEIA-CFEAGEQGGTYNGNPLMTAVGVAVIKELLKPGFMESVRERGQYLRQRSLEISE 323 Query: 325 RYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEE 384 +YG F RG GLL L D Q + ++ G+++ N++RF PALNV++E Sbjct: 324 KYG-FEGERGEGLLRALQLGRDIGPQIVEAARNLEPVGLLLNSPRPNLLRFMPALNVTKE 382 Query: 385 EV 386 E+ Sbjct: 383 EI 384 Lambda K H 0.319 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 400 Length adjustment: 31 Effective length of query: 375 Effective length of database: 369 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory