Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate HSERO_RS19190 HSERO_RS19190 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::P22256 (426 letters) >FitnessBrowser__HerbieS:HSERO_RS19190 Length = 427 Score = 170 bits (431), Expect = 7e-47 Identities = 125/356 (35%), Positives = 176/356 (49%), Gaps = 36/356 (10%) Query: 3 SNKELMQRRSQAIPRGVGQI---------HPIFADRAENCRVWDVEGREYLDFAGGIAVL 53 +N L R Q+ P GV P F +RAE WD EG+ Y+D+ G Sbjct: 4 TNASLFARAQQSTPGGVNSPVRAFRSVGGTPRFIERAEGPWFWDAEGKRYIDYIGSWGPA 63 Query: 54 NTGHLHPKVVAAVE-AQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGS 112 GH HP+V+ AV+ A + LS E +E+ E + + VP ++ LV++G+ Sbjct: 64 IVGHAHPEVIQAVQQAAARGLSFGA----PTEAEIEMAEEIIKLVPS--IEQIRLVSSGT 117 Query: 113 EAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKV-----NPYSAGMGLMPGHVY 167 EA +A+++AR AT R I F G YHG L G NP SAG+ P Sbjct: 118 EATMSALRLARGATGRDKIIKFEGCYHGHADSLLVKAGSGLLTFGNPTSAGV---PEDFA 174 Query: 168 RALYPCPLHGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRA 227 + + +DA A + FK A +IA +++EPV G +S F++ +R Sbjct: 175 KHTLV-----LDYNDA-AQLEEAFKT--AGNEIACVIVEPVAGNMNLVRASDEFLRTMRR 226 Query: 228 LCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMD 287 LC E+G +LI DEV SG R A E G+ PDLT K I GG P+A GRAEVM Sbjct: 227 LCTEYGAILIFDEVMSGF-RVARGGAQELNGIVPDLTALGKVIGGGLPVAAFGGRAEVMK 285 Query: 288 AVAP-GGL--GGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAE 340 +AP GG+ GT +GNP+ A + LK+ +Q + + +KL DGL A A+ Sbjct: 286 HLAPLGGVYQAGTLSGNPVTVAAGMATLKIIQQPDFYTNLSTQTRKLADGLAAAAQ 341 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 427 Length adjustment: 32 Effective length of query: 394 Effective length of database: 395 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory