Align Putative asparagine synthetase [glutamine-hydrolyzing] 2; EC 6.3.5.4 (uncharacterized)
to candidate HSERO_RS21005 HSERO_RS21005 asparagine synthase
Query= curated2:Q58456 (515 letters) >FitnessBrowser__HerbieS:HSERO_RS21005 Length = 623 Score = 228 bits (580), Expect = 6e-64 Identities = 159/482 (32%), Positives = 244/482 (50%), Gaps = 52/482 (10%) Query: 1 MCGINGIIRF-GKEVIKEEINKMNKAIKHRGPDDEGIFIYNFKNYSIGLGHVRLAILDLS 59 MCGI G+I F G V E + +M AI HRGPD EG +I ++GLGH RL+I+DLS Sbjct: 1 MCGITGLINFDGSPVAPEVLKRMTNAIMHRGPDGEGHWIEG----NVGLGHRRLSIIDLS 56 Query: 60 EKGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGEIYNYLELK---EKFNLETETGTDTE 116 GHQPM I D ++ YNGEIYNY EL+ E + TDTE Sbjct: 57 SAGHQPM---------ISTDHRF-----LLTYNGEIYNYRELRTELEALGYWFRSQTDTE 102 Query: 117 VILKLYNKLGFDCVKEFNGMWAFCIFDKKKGLIFCSRDRLGVKPFYYYWDGNEFIFSSEL 176 V+L G D + FNGM+A ++D+K+ + +RDR G+KP YY F SE Sbjct: 103 VVLHALECWGRDALLRFNGMFALALWDRKERELLLARDRYGIKPLYYARQAGCLAFGSEQ 162 Query: 177 KGILAVKEINKKENINKDAVELYFALGFIPSPYSIYKNTFKLEARQNLIFDLDKREIRKY 236 K I AV +K ++ A+ YF I + ++ ++ L A + + +++ + Sbjct: 163 KAITAVPAFQRK--LDLPALLEYFTFQNIFTDRTLLEDVRILPAGHYAVLKQGQNDLKLF 220 Query: 237 YYWELPDYKP--IYDKKKLIEEGKKLLYDAVKIRMRSDVPVGAFLSGGLDSSTVVGVMRE 294 YW+ +P DK+ +EE +L AV ++ SDV +GA+LSGG+DS ++ + + Sbjct: 221 RYWDYRFREPEVAADKQAYLEELDRLFKQAVNRQLVSDVELGAYLSGGMDSGSITAIAAK 280 Query: 295 FTDLSKLHTFSIGF--------EGKYDETPYIKIVVDYFKTQHHHYYFKERDFEELIDKY 346 L TF+ GF E +DE + + FKT+H+ K D E + + Sbjct: 281 --SFPNLKTFTCGFDLSSASGIELAFDERTKAEAMSARFKTEHYEMVLKAGDMERCLPRL 338 Query: 347 SWIYDEPFGDYSGFPTYKVSEMARKFVTVVLSGDGGDEVFGGY--MTHLNGYRMDFIRKL 404 +W +EP S +P Y +++A KFV VVLSG GGDE+FGGY + DF + Sbjct: 339 AWHLEEPRVGQS-YPNYYAAKLAGKFVKVVLSGSGGDELFGGYPWRYYRAAMSQDFEHYI 397 Query: 405 PKFL----RVVGSK------LPVKKDLNGIANLYLLKEAFRL---SLINPEEFYAESIKE 451 ++ R+V ++ PVK+ ++G+ + ++ F +L PE++ S+ Sbjct: 398 DQYYLYWQRLVDNRHLKQMFAPVKQQVDGVWTRDIFRDVFATHDNALDRPEDYINHSLYF 457 Query: 452 DA 453 +A Sbjct: 458 EA 459 Lambda K H 0.322 0.144 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 799 Number of extensions: 49 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 623 Length adjustment: 36 Effective length of query: 479 Effective length of database: 587 Effective search space: 281173 Effective search space used: 281173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
Align candidate HSERO_RS21005 HSERO_RS21005 (asparagine synthase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.26266.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-142 459.8 0.0 5.6e-139 450.3 0.0 2.0 2 lcl|FitnessBrowser__HerbieS:HSERO_RS21005 HSERO_RS21005 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS21005 HSERO_RS21005 asparagine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.3 0.0 5.6e-139 5.6e-139 1 491 [. 2 506 .. 2 514 .. 0.87 2 ! 7.7 0.0 8.1e-05 8.1e-05 490 517 .] 528 555 .. 519 555 .. 0.91 Alignments for each domain: == domain 1 score: 450.3 bits; conditional E-value: 5.6e-139 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsn 67 Cgi+g+++ + + e +k+m++++ hRGPD+eg+w++ n++lghrRL+iidls++ +QP+ + lcl|FitnessBrowser__HerbieS:HSERO_RS21005 2 CGITGLINFDGSPVA-PEVLKRMTNAIMHRGPDGEGHWIE---GNVGLGHRRLSIIDLSSAgHQPMIS 65 *********987555.69**********************...8**************9999****** PP TIGR01536 68 ek.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkg 134 ++ + ++++nGEIYN++eLr ele+ Gy F++++DtEV+L+a+e wg++++ r++GmFA+alwd+k++ lcl|FitnessBrowser__HerbieS:HSERO_RS21005 66 TDhRFLLTYNGEIYNYRELRTELEALGYWFRSQTDTEVVLHALECWGRDALLRFNGMFALALWDRKER 133 **999*************************************************************** PP TIGR01536 135 elflaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevke 202 el+laRDr+GikPLYya+++g l+f+SE Ka++a+++++++ld al e++t+q+ t++tl ++v+ lcl|FitnessBrowser__HerbieS:HSERO_RS21005 134 ELLLARDRYGIKPLYYARQAGCLAFGSEQKAITAVPAFQRKLDLPALLEYFTFQNIFTDRTLLEDVRI 201 ******************************************************999*********** PP TIGR01536 203 lepakal.....dgeekleeywevekee..vkeseeelveelrelledavkkrlvadvpvgvllSGGl 263 l++++++ +++ kl +yw+ + +e v++++++ eel++l+++av+++lv+dv++g++lSGG+ lcl|FitnessBrowser__HerbieS:HSERO_RS21005 202 LPAGHYAvlkqgQNDLKLFRYWDYRFREpeVAADKQAYLEELDRLFKQAVNRQLVSDVELGAYLSGGM 269 ******99996655666666***99888779999********************************** PP TIGR01536 264 DSslvaaiakkeaksevktFsigfe.dsk.....dldeskaarkvadelgtehkevliseeevlkele 325 DS +++aia+k ++ ++ktF+ gf+ s+ ++de + a+++++ + teh+e+++++ ++ l+ lcl|FitnessBrowser__HerbieS:HSERO_RS21005 270 DSGSITAIAAKSFP-NLKTFTCGFDlSSAsgielAFDERTKAEAMSARFKTEHYEMVLKAGDMERCLP 336 **************.8********9544333333588889**************************** PP TIGR01536 326 evilaleeptairasiplyllsklarekgvkVvLsGeGaDElfgGYey.freakaeeale......lp 386 ++ ++leep + +s+p y ++kla + vkVvLsG G+DElfgGY + + +a +++++e + lcl|FitnessBrowser__HerbieS:HSERO_RS21005 337 RLAWHLEEPR-VGQSYPNYYAAKLAGKF-VKVVLSGSGGDELFGGYPWrYYRAAMSQDFEhyidqyYL 402 *********9.999**************.*****************8546666777777734333322 PP TIGR01536 387 easelaekklllqaklak.eselkellkakleeelkekeelkkelkee.....seleellrldlelll 448 + ++l +++l +++a +++ ++ +++ +++ ++++ + ++++ l+ +++++l lcl|FitnessBrowser__HerbieS:HSERO_RS21005 403 YWQRLVDNRHLK-QMFAPvKQQVDGVWTRDIFRDVFATHDN------AldrpeDYINHSLYFEAKTFL 463 222222222222.3333303333344444444444443333......1233348999*********** PP TIGR01536 449 sdllrakDrvsmahslEvRvPflDkelvelalsippelklrdg 491 ++l ++D++smah+lE+RvPf+D++lv++a++ p++lkl++ lcl|FitnessBrowser__HerbieS:HSERO_RS21005 464 HGLFVVEDKLSMAHGLESRVPFMDNDLVDFAMQCPVNLKLNNL 506 ***************************************9975 PP == domain 2 score: 7.7 bits; conditional E-value: 8.1e-05 TIGR01536 490 dgkeKvlLreaaeellPeeileRkKeaf 517 ++ K lLr ++++++P+++ + +K++f lcl|FitnessBrowser__HerbieS:HSERO_RS21005 528 TNDGKQLLRDMMARYIPDDVTKAEKQGF 555 6889**********************99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (623 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.02s 00:00:00.04 Elapsed: 00:00:00.02 # Mc/sec: 11.37 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory