Align 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 (characterized)
to candidate HSERO_RS18420 HSERO_RS18420 3-phosphoshikimate 1-carboxyvinyltransferase
Query= SwissProt::P24497 (427 letters) >FitnessBrowser__HerbieS:HSERO_RS18420 Length = 443 Score = 454 bits (1167), Expect = e-132 Identities = 248/430 (57%), Positives = 302/430 (70%), Gaps = 10/430 (2%) Query: 4 LTLQPIARVDGTVNLPGSKSVSNRALLLAALARGTTVLTNLLDSDDVRHMLNALSALGVH 63 + L P+ V GTV LPGSKS+SNR LLLAAL+ GTT + +LL SDD ML AL LGV Sbjct: 10 IDLAPVHHVQGTVKLPGSKSISNRILLLAALSGGTTRIFDLLASDDTLVMLMALQTLGVK 69 Query: 64 YVLSSDRTRCEVTGTGGPLQAGSALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPRMKE 123 + V G G L A +LF+GNAGTA+RPL AAL + D L G PRM E Sbjct: 70 WEQIEGTQDYIVHGVNGVLPVHQA-DLFMGNAGTAIRPLTAALAVLGGDYTLHGVPRMHE 128 Query: 124 RPIGHLVDALRQGGAQIDYLEQENYPPLRLRGG-FTGGDVEVDGSVSSQFLTALLMASPL 182 RPIG LVDAL G +IDY YPPL +R G T ++V G+VSSQFLTALLMA+PL Sbjct: 129 RPIGDLVDALNAVGMRIDYTGNPGYPPLHIRRGQLTSSRMKVRGNVSSQFLTALLMAAPL 188 Query: 183 APQDTVIAIK--GELVSRPYIDITLHLMKTFGVEVENQAYQRFIVRGNQQYQSPGDYLVE 240 ++ + I GEL+S+PYI+ITL+LM+ F VEVE +Q+FI++ Q Y+SPG VE Sbjct: 189 MAREEAMQIDVVGELISKPYIEITLNLMRRFSVEVERDGWQQFIIKPGQHYRSPGSIHVE 248 Query: 241 GDASSASYFLAAGAIKGGTVKVTGIGRNSVQGDIRFADVLEKMGATVTWGEDYI-ACTRG 299 GDASSASYFLAAGAI GG ++V G+GR+S+QGD+RF + LE MGAT+T GE++I A + G Sbjct: 249 GDASSASYFLAAGAITGGPIRVEGVGRDSIQGDVRFVEALELMGATITMGENWIEASSNG 308 Query: 300 ELNAIDMDMNHIPDAAMTIATAALFARGTTTLRNIYNWRVKETDRLFAMATELRKVGAEV 359 L A+D D NHIPDAAMTIA AAL+A G +TLRNI +WRVKETDRL AMATELRK+GA+V Sbjct: 309 PLKAVDADFNHIPDAAMTIAVAALYADGPSTLRNIASWRVKETDRLAAMATELRKLGAQV 368 Query: 360 EEGEDYIRITPPLTLQFAEIGTYNDHRMAMCFSLVALS-----DTPVTILDPKCTAKTFP 414 EEG DY+ +TPP + A I TY+DHRMAMCFSL +L V I DPKC AKTFP Sbjct: 369 EEGADYLTVTPPAEIGTATIDTYDDHRMAMCFSLASLDGALRRGNRVRINDPKCVAKTFP 428 Query: 415 DYFGQLARIS 424 DYF +I+ Sbjct: 429 DYFDVFKKIA 438 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 443 Length adjustment: 32 Effective length of query: 395 Effective length of database: 411 Effective search space: 162345 Effective search space used: 162345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS18420 HSERO_RS18420 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.8766.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-143 465.0 0.0 1.2e-143 464.8 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS18420 HSERO_RS18420 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS18420 HSERO_RS18420 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.8 0.0 1.2e-143 1.2e-143 1 413 [. 20 438 .. 20 440 .. 0.95 Alignments for each domain: == domain 1 score: 464.8 bits; conditional E-value: 1.2e-143 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakve..eekeelviegvgg. 65 g +k+pgsKSis+R+lllaaL+ g+t++ +lL s+Dtl++l al+ lG+k e e+ ++ +++gv+g lcl|FitnessBrowser__HerbieS:HSERO_RS18420 20 GTVKLPGSKSISNRILLLAALSGGTTRIFDLLASDDTLVMLMALQTLGVKWEqiEGTQDYIVHGVNGv 87 789************************************************97444999*******98 PP TIGR01356 66 lkepeaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslP 133 l +a l +gn+Gt++R+lt++la+++g+++l g +++++RPi++lv+aL+++g++i+++ + g++P lcl|FitnessBrowser__HerbieS:HSERO_RS18420 88 LPVHQADLFMGNAGTAIRPLTAALAVLGGDYTLHGVPRMHERPIGDLVDALNAVGMRIDYTGNPGYPP 155 88888*************************************************************** PP TIGR01356 134 laisgp.lkggivelsgsaSsQyksalllaap..lalqavtleivgeklisrpyieitLkllksfgve 198 l+i+ + l++ ++++g++SsQ+++all+aap +++a ++ +vg +lis+pyieitL+l+++f ve lcl|FitnessBrowser__HerbieS:HSERO_RS18420 156 LHIRRGqLTSSRMKVRGNVSSQFLTALLMAAPlmAREEAMQIDVVG-ELISKPYIEITLNLMRRFSVE 222 ***8665888**********************65455667777777.********************* PP TIGR01356 199 veeederkivvkggqkykqk.evevegDaSsAafflaaaaitgeevtvenlgenstqgdkaiiivLee 265 ve++ +++++k+gq+y+++ +++vegDaSsA++flaa+aitg+ ++ve++g +s qgd+++++ Le lcl|FitnessBrowser__HerbieS:HSERO_RS18420 223 VERDGWQQFIIKPGQHYRSPgSIHVEGDASSASYFLAAGAITGGPIRVEGVGRDSIQGDVRFVEALEL 290 ***999**********99888*********************************************** PP TIGR01356 266 mGadveveeqrdvevegasklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRia 333 mGa++++ e+ ++e ++ lk+v+ +d+++++D+++t+av+a++A+g+++++ni+++RvkE+dR+a lcl|FitnessBrowser__HerbieS:HSERO_RS18420 291 MGATITMGEN-WIEASSNGPLKAVD--ADFNHIPDAAMTIAVAALYADGPSTLRNIASWRVKETDRLA 355 **********.9****999999999..***************************************** PP TIGR01356 334 aiaeeLeklGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaae....geveiedaec 397 a+a+eL+klG++vee++d+l++++ +e+ +a++dtydDHR+am++++++l + ++v+i+d++c lcl|FitnessBrowser__HerbieS:HSERO_RS18420 356 AMATELRKLGAQVEEGADYLTVTPP-AEIGTATIDTYDDHRMAMCFSLASLDGAlrrgNRVRINDPKC 422 *************************.6**********************87533223389******** PP TIGR01356 398 vaksfPeFfevleqlg 413 vak+fP++f+v +++ lcl|FitnessBrowser__HerbieS:HSERO_RS18420 423 VAKTFPDYFDVFKKIA 438 ***********99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (443 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 12.56 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory