Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate HSERO_RS20920 HSERO_RS20920 3-dehydroquinate synthase
Query= BRENDA::A0A0M3KL09 (179 letters) >FitnessBrowser__HerbieS:HSERO_RS20920 Length = 596 Score = 181 bits (458), Expect = 3e-50 Identities = 95/161 (59%), Positives = 118/161 (73%) Query: 10 NIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETV 69 +I+LVG MGAGKTT+GR LA+ L + F+DSDHEIE +TGATIP IFE EGE FR RE Sbjct: 4 SIFLVGLMGAGKTTIGRALAKKLNKRFIDSDHEIEARTGATIPVIFEIEGEENFRRREAE 63 Query: 70 VLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQV 129 V+ ELT+ +VLATGGGAI +A NR+ LK+ G VVYL + LQRT RDKNRPLLQ Sbjct: 64 VIRELTALPDIVLATGGGAILRAENRDNLKKGGTVVYLRASINQILQRTGRDKNRPLLQT 123 Query: 130 ENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKIL 170 +P +KL +L + RDPLYR+VA + IETN+ + L Q I+ Sbjct: 124 ADPRRKLEELSRQRDPLYRDVADFVIETNRPNVQFLVQTII 164 Lambda K H 0.318 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 596 Length adjustment: 28 Effective length of query: 151 Effective length of database: 568 Effective search space: 85768 Effective search space used: 85768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory