Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate HSERO_RS18310 HSERO_RS18310 O-acetylhomoserine aminocarboxypropyltransferase
Query= BRENDA::E9AFE7 (409 letters) >FitnessBrowser__HerbieS:HSERO_RS18310 Length = 429 Score = 221 bits (564), Expect = 2e-62 Identities = 140/422 (33%), Positives = 211/422 (50%), Gaps = 41/422 (9%) Query: 25 FDTLQVHAGVRPDPVTGAILTPIYQSTTFVQESIN------SYQAKGYSYTRSANPTVAV 78 F+T+ VH G PDP T A+ PIYQ+ F + + +G Y+R NPT V Sbjct: 9 FETISVHGGYDPDPTTRAVAVPIYQTVAFAFDDTQHGADLFDLKVQGNIYSRIMNPTQDV 68 Query: 79 LEQKLCALENGSYCTVYNTGMAATTTAISSFMNAGDHAILTNCCYGGTNRACRVFFSRLG 138 LE++L ALE G +G AA T AI + AGD+ + + YGGT + G Sbjct: 69 LEKRLAALEGGIGALALASGQAAVTYAIQTIAEAGDNIVSASTLYGGTYNLFAHTLPQYG 128 Query: 139 MEFTFVDMRDPQNVIDSIKPNTKLVISETPANPTLILIDVAAVSKICKERGIVHMCDNTF 198 ++ F D R P + I TK + E+ NP + D+AAV+ I G+ + DNT Sbjct: 129 VQTRFADPRQPASFEPLIDDRTKAIYIESIGNPLGNITDIAAVADIAHRHGVPLIVDNTV 188 Query: 199 ATAYIMRPLDHGADVTLISTTKYVDGHDMTVGGALVTNSKELDAK--------------- 243 AT Y++RP +HGAD+ + S TKY+ GH T+GGA+V + K AK Sbjct: 189 ATPYLLRPFEHGADIVVHSLTKYLGGHGTTLGGAIVDSGKFPWAKHKQRFKRLNEPDVSY 248 Query: 244 --VRLTQNI----------------LGNVMSPQVAFLQLQTVKTMSLRVTKQSHNAQKIA 285 V T+ + +G +SP AF LQ ++T+ LR+ + + N +A Sbjct: 249 HGVVYTEALGEAAYIGRARVVPLRNMGAALSPFNAFQILQGIETLGLRLDRITANTLAVA 308 Query: 286 EFLETHRAVDRVVYPGLASHPQKELADRQHRNNLHGGMLWFEVKGGTAAGRRLMDTVPRP 345 ++L+ H V V Y GL HP LA + G+L F V G G R D + + Sbjct: 309 QYLKRHPKVRWVNYAGLEDHPDHALAQTYFKGRA-SGVLTFGVANGREGGARFQDAL-QL 366 Query: 346 WSLCENLGASESIITCPSVMTHANMTSEDRMKVGITDGFVRVSCGIEDVDDLIAALKVAM 405 ++ N+G ++S+ T P+ TH ++ + K G+T+ VR+S GIE +DDL+A L+ A+ Sbjct: 367 FTRLVNIGDAKSLATHPASTTHRQLSPTELEKAGVTEDTVRLSIGIEHIDDLLADLEQAL 426 Query: 406 DA 407 + Sbjct: 427 QS 428 Lambda K H 0.319 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 409 Length of database: 429 Length adjustment: 32 Effective length of query: 377 Effective length of database: 397 Effective search space: 149669 Effective search space used: 149669 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory