Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate HSERO_RS21555 HSERO_RS21555 3-phosphoglycerate dehydrogenase
Query= BRENDA::Q972A9 (313 letters) >FitnessBrowser__HerbieS:HSERO_RS21555 Length = 328 Score = 110 bits (276), Expect = 3e-29 Identities = 80/265 (30%), Positives = 133/265 (50%), Gaps = 12/265 (4%) Query: 49 IIVVRSRTKVTKDVIEKGKKLKIIARAGIGLDNIDTEEAEKRNIKVVYAPGASTDSAVEL 108 ++++R RT +T+ ++EK LK++++ G ++D +R I +V G T A EL Sbjct: 50 VVLIRERTALTRPLLEKLPLLKLVSQTGKVSGHVDVAACTERGIAIVEGVGDPTAPA-EL 108 Query: 109 TIGLMIAAARKMYTSMALAKSGIFKKIE--------GLELAGKTIGIVGFGRIGTKVGII 160 T L++AA R++ + ++G ++++ G L G+T+GI G+G+IG V Sbjct: 109 TWALIMAAMRRVPQYCSALRAGAWQQVSPTPHHNLIGTALKGRTLGIWGYGKIGRLVAGY 168 Query: 161 ANAMGMKVLAYDILDIREKAEKINAKAV-SLEELLKNSDVISLHVTVSKDAKPIIDYPQF 219 A GM+VL + RE+A K +A S EE +DV+SLH+ ++ + I+ Sbjct: 169 GRAFGMQVLVWGRDSSREQAIKDGYQAAASKEEFFAQADVLSLHLRLNDATRGIVKASDL 228 Query: 220 ELMKDNVIIVNTSRAVAVNGKALLDYIKKGKVYAYATDVFWNEPPKEEWELELLKHERVI 279 MK VNTSRA V AL + G+ A DV+ EP E LL+ + V+ Sbjct: 229 ARMKATACFVNTSRAELVEPDALEAALIAGRPGLAALDVYEREPLPV--ESALLQMDNVV 286 Query: 280 VTTHIGAQTKEAQKRVAEMTTQNLL 304 H+G K+ + QN++ Sbjct: 287 AAPHLGYVEKDGYELYFRAAFQNIV 311 Lambda K H 0.317 0.134 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 328 Length adjustment: 28 Effective length of query: 285 Effective length of database: 300 Effective search space: 85500 Effective search space used: 85500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory