Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate HSERO_RS17580 HSERO_RS17580 hypothetical protein
Query= SwissProt::Q94AL9 (477 letters) >FitnessBrowser__HerbieS:HSERO_RS17580 Length = 440 Score = 178 bits (452), Expect = 3e-49 Identities = 132/418 (31%), Positives = 200/418 (47%), Gaps = 34/418 (8%) Query: 84 VDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYLNHAIAD 143 V G+ L D+ G+RY+DA G AV GH HP V+E + Q+ L + + A A+ Sbjct: 17 VAGEGMELIDQDGKRYIDASGGAAVSCLGHGHPRVIEAIRKQVGELAYAHTSFFTTAPAE 76 Query: 144 -FSEALASKLPGDLKVVFFTNSGTEANELALMMAKLY------TGCQDIVAVRNGYHGNA 196 + LA PG L V+F + G+EA E AL +A+ Y + I+A R YHGN Sbjct: 77 ELAAMLADAAPGSLNHVYFLSGGSEAVEAALKLARQYYVEVGQPQRRHIIARRQSYHGNT 136 Query: 197 AATMGATGQSMWK---FNVVQNSVHHALNPDPYRGVFGSDGE-------KYAKDLQDLIQ 246 + A G + W+ F + HH YR +DGE + A +L+ I Sbjct: 137 LGAL-AIGGNAWRREMFMPMLIEAHHVSPCYAYRN--RADGESDVQYVQRLADELEQKIL 193 Query: 247 YGTTGHIAGFICEAIQGV-GGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFW 305 + F+ E + G G V Y K G L I DEV SG RTG + Sbjct: 194 SLGADQVIAFVAETVVGATAGAVPPVGDYFRKIRAVCDKYGVLLILDEVMSGMGRTGYLF 253 Query: 306 GFEAHNVVPDIVTMAKGIGNGF-PLGAVVTTPEIAGVLTRRSYF----NTFGGNSVSTTA 360 E VVPDIV +AKG+G G+ P+GA++ + I + R S F +T+ G++ + A Sbjct: 254 ACEEDGVVPDIVVIAKGLGAGYQPIGAMICSDHIYDAVLRGSGFFQHGHTYIGHATACAA 313 Query: 361 GLAVLNVIEKEKLQENAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKT 420 +AV I++E+L EN G L+ +L Q +GD+RGRGL +GVELV++R K Sbjct: 314 AVAVQKTIQEERLLENVRQRGEQLRSELRQAFGDQAHVGDIRGRGLFVGVELVAERSSKL 373 Query: 421 PATAET---LHIMDQMKELGVLIGK-----GGYFGNVFRITPPLCFTKDDADFLVEAM 470 P + + + + + G+L+ G G+ + PP + +D +V+ + Sbjct: 374 PLSPDLRTHARVKAEAMKRGLLVYPMGGTIDGKNGDHILLAPPFIASSNDISEIVQRL 431 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 440 Length adjustment: 33 Effective length of query: 444 Effective length of database: 407 Effective search space: 180708 Effective search space used: 180708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory