Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate HSERO_RS21020 HSERO_RS21020 imidazole glycerol phosphate synthase
Query= BRENDA::A4WHB6 (251 letters) >FitnessBrowser__HerbieS:HSERO_RS21020 Length = 253 Score = 168 bits (426), Expect = 9e-47 Identities = 95/230 (41%), Positives = 144/230 (62%), Gaps = 6/230 (2%) Query: 1 MAVRVIPCLDMDGKAGVVVKGVNFEGVREVGDPVEMAVRYEEEGADEIAILDITATPEGR 60 + RVIP L + ++ +VK F VGDP + E DE+ LDI A+ E + Sbjct: 2 LRTRVIPALLLQHES--LVKTQRFSTFDYVGDPCNTVRIFNELEVDELFFLDIAASREKK 59 Query: 61 STFVESVRRVAEAVSIPVLVGGGVRGIEDAAALFKAGADKVSVNTAAVKNPRLVSEIARE 120 ++ + +A +P+ GGG+R ++DA ++F G +KV+VNT A++NP L+SEIA E Sbjct: 60 GPNLQLLADIANECFMPLGYGGGIRSLDDARSVFSIGFEKVAVNTHALENPSLISEIATE 119 Query: 121 FGSQSTVVAIDAK--LVGGRYEVFVRGGKEPTGLDAVEWAKKVEELGAGEILLTSIDKDG 178 +GSQ+ VV++D K ++GG+ V G+ TG D V WA++ E LGAGE+ LT+ID++G Sbjct: 120 YGSQAVVVSVDVKGGVLGGQ-TVRSHSGRHNTGRDPVAWAQEAERLGAGELFLTAIDREG 178 Query: 179 TRLGYDVELIRRVAEAVKIPVIASGGAGALEHFYEAA-AAGADAVLAASL 227 T G+D++L+++V +AV IPVIA GGAG+L + AGA AV S+ Sbjct: 179 TWSGFDIDLVKKVTDAVSIPVIAHGGAGSLSDIRKVVKQAGASAVALGSM 228 Lambda K H 0.318 0.136 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 253 Length adjustment: 24 Effective length of query: 227 Effective length of database: 229 Effective search space: 51983 Effective search space used: 51983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory