Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate HSERO_RS20350 HSERO_RS20350 ATP phosphoribosyltransferase
Query= reanno::HerbieS:HSERO_RS20350 (216 letters) >FitnessBrowser__HerbieS:HSERO_RS20350 Length = 216 Score = 415 bits (1067), Expect = e-121 Identities = 216/216 (100%), Positives = 216/216 (100%) Query: 1 MTQQLTLALSKGRIFEETLPLLKAAGITVSEDPESSRKLILPTNDPDVRVIIVRASDVPT 60 MTQQLTLALSKGRIFEETLPLLKAAGITVSEDPESSRKLILPTNDPDVRVIIVRASDVPT Sbjct: 1 MTQQLTLALSKGRIFEETLPLLKAAGITVSEDPESSRKLILPTNDPDVRVIIVRASDVPT 60 Query: 61 YVQYGAADFGVAGKDVLLEHGGEGLYQPIDLNIAKCRLSVAVQEGFDYANAVRQGARLRV 120 YVQYGAADFGVAGKDVLLEHGGEGLYQPIDLNIAKCRLSVAVQEGFDYANAVRQGARLRV Sbjct: 61 YVQYGAADFGVAGKDVLLEHGGEGLYQPIDLNIAKCRLSVAVQEGFDYANAVRQGARLRV 120 Query: 121 VTKYVNTAREHFAAKGVHVDLIKLYGSMELGPLVGLSDAIVDLVSTGGTLRANKLVEVEH 180 VTKYVNTAREHFAAKGVHVDLIKLYGSMELGPLVGLSDAIVDLVSTGGTLRANKLVEVEH Sbjct: 121 VTKYVNTAREHFAAKGVHVDLIKLYGSMELGPLVGLSDAIVDLVSTGGTLRANKLVEVEH 180 Query: 181 IIDISSRLVVNQAALKLKRERLQPILDAFEKASKAK 216 IIDISSRLVVNQAALKLKRERLQPILDAFEKASKAK Sbjct: 181 IIDISSRLVVNQAALKLKRERLQPILDAFEKASKAK 216 Lambda K H 0.318 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 216 Length adjustment: 22 Effective length of query: 194 Effective length of database: 194 Effective search space: 37636 Effective search space used: 37636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate HSERO_RS20350 HSERO_RS20350 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.18861.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-63 198.4 0.0 5.7e-63 198.2 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20350 HSERO_RS20350 ATP phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20350 HSERO_RS20350 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.2 0.0 5.7e-63 5.7e-63 1 183 [] 5 190 .. 5 190 .. 0.95 Alignments for each domain: == domain 1 score: 198.2 bits; conditional E-value: 5.7e-63 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGit 66 l++Al KGr++eetl ll++ag+++s+ +rkli ++d++v+v+++ra+d+ptyv++gaad+G+ lcl|FitnessBrowser__HerbieS:HSERO_RS20350 5 LTLALSKGRIFEETLPLLKAAGITVSEDPesSRKLILPTNDPDVRVIIVRASDVPTYVQYGAADFGVA 72 79***********************9987789************************************ PP TIGR00070 67 GkDlleEsead.vvelldlgfgkcklvlAvpeesdvesledlkegk..riATkypnltreylekkgvk 131 GkD+l E++ + +++ +dl++ kc+l++Av+e d+ + ++++g+ r+ Tky+n++re+++ kgv+ lcl|FitnessBrowser__HerbieS:HSERO_RS20350 73 GKDVLLEHGGEgLYQPIDLNIAKCRLSVAVQEGFDYAN--AVRQGArlRVVTKYVNTAREHFAAKGVH 138 *******88777**********************9988..44444346******************** PP TIGR00070 132 veivkleGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 v+++kl+G++El pl+gl+daIvD+v+tG tLr+n+L+++e+i+++s+rl++ lcl|FitnessBrowser__HerbieS:HSERO_RS20350 139 VDLIKLYGSMELGPLVGLSDAIVDLVSTGGTLRANKLVEVEHIIDISSRLVV 190 *************************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (216 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory