Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate HSERO_RS20325 HSERO_RS20325 imidazole glycerol phosphate synthase
Query= reanno::HerbieS:HSERO_RS20325 (212 letters) >FitnessBrowser__HerbieS:HSERO_RS20325 Length = 212 Score = 439 bits (1130), Expect = e-128 Identities = 212/212 (100%), Positives = 212/212 (100%) Query: 1 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL 60 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL Sbjct: 1 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL 60 Query: 61 RESGVQDAVIEASRTKPLFGVCVGEQMLFDWSEEGDTPGLGLLPGKVVRFDLEGMRQDDG 120 RESGVQDAVIEASRTKPLFGVCVGEQMLFDWSEEGDTPGLGLLPGKVVRFDLEGMRQDDG Sbjct: 61 RESGVQDAVIEASRTKPLFGVCVGEQMLFDWSEEGDTPGLGLLPGKVVRFDLEGMRQDDG 120 Query: 121 SLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFACA 180 SLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFACA Sbjct: 121 SLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFACA 180 Query: 181 VARDNIFATQFHPEKSASAGLQLYRNFVHWKP 212 VARDNIFATQFHPEKSASAGLQLYRNFVHWKP Sbjct: 181 VARDNIFATQFHPEKSASAGLQLYRNFVHWKP 212 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 212 Length adjustment: 21 Effective length of query: 191 Effective length of database: 191 Effective search space: 36481 Effective search space used: 36481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate HSERO_RS20325 HSERO_RS20325 (imidazole glycerol phosphate synthase)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.7594.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-67 211.6 0.0 5.5e-67 211.4 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20325 HSERO_RS20325 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20325 HSERO_RS20325 imidazole glycerol phosphate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 211.4 0.0 5.5e-67 5.5e-67 1 197 [. 4 209 .. 4 210 .. 0.92 Alignments for each domain: == domain 1 score: 211.4 bits; conditional E-value: 5.5e-67 TIGR01855 1 ivvidygvgNlksvkkalerv..gaesevvkdskelekadklvlPGVGafkeamkklrelelellaek 66 ivv+dyg+gNl+sv++al++v +a ++++ + +++ ad++vlPG Ga+ ++m++lre++++ + + lcl|FitnessBrowser__HerbieS:HSERO_RS20325 4 IVVVDYGMGNLRSVAQALRHVapEADVRISGEVADIRAADRVVLPGQGAMPDCMRSLRESGVQDAVIE 71 89******************9334556777888999*************************7777555 PP TIGR01855 67 vvkkkkpvlgiClGmQllfekseEgkevkglglikgkvkkleaek.........kvPhiGWnevevvk 125 ++++kp+ g+C+G Q+lf+ seEg +++glgl++gkv++++ e kvP++GWn+v+ ++ lcl|FitnessBrowser__HerbieS:HSERO_RS20325 72 -ASRTKPLFGVCVGEQMLFDWSEEG-DTPGLGLLPGKVVRFDLEGmrqddgslfKVPQMGWNHVHQTS 137 .55667******************7.68************9877666788999*************** PP TIGR01855 126 esellkgleeearvYfvHsYaveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllk 193 ++l +g+ ++a +YfvHsY+++++e+ +v+ ++ yg++f +av++dni+++QFHPEkS+++Gl+l + lcl|FitnessBrowser__HerbieS:HSERO_RS20325 138 RHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFACAVARDNIFATQFHPEKSASAGLQLYR 205 ******************************************************************** PP TIGR01855 194 nfle 197 nf++ lcl|FitnessBrowser__HerbieS:HSERO_RS20325 206 NFVH 209 **97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (212 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.34 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory