Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate HSERO_RS19570 HSERO_RS19570 ribose-phosphate pyrophosphokinase
Query= BRENDA::P0A719 (315 letters) >FitnessBrowser__HerbieS:HSERO_RS19570 Length = 316 Score = 405 bits (1040), Expect = e-118 Identities = 199/313 (63%), Positives = 254/313 (81%), Gaps = 1/313 (0%) Query: 1 MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC 60 + ++ +F GNA PELA+ +A +L LG A V +FSDGEV V+INENVRG D+F++QSTC Sbjct: 3 LENLMVFTGNANPELARGVAEKLGIPLGKANVSKFSDGEVMVEINENVRGKDVFVLQSTC 62 Query: 61 APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV 120 APTNDNLME+++MVDAL+RASAGRITA IPY+GYARQDRR RSARV I+AKVVA+ L Sbjct: 63 APTNDNLMEIMIMVDALKRASAGRITAAIPYYGYARQDRRPRSARVAISAKVVANMLQEA 122 Query: 121 GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAI 180 GV+RVL +DLHA+QIQGFFD+PVDN++ SPILL D++ N ++ +VVSPD+GGVVRARA+ Sbjct: 123 GVERVLIMDLHADQIQGFFDIPVDNIYASPILLGDLVNKNYEDLLVVSPDVGGVVRARAL 182 Query: 181 AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERG 240 AK LN D+AIIDKRRP+ANVS+VM+IIG+V GR+CV++DDM+DT GTL KAAE LKERG Sbjct: 183 AKRLN-CDLAIIDKRRPKANVSEVMNIIGEVEGRNCVIMDDMVDTAGTLTKAAEVLKERG 241 Query: 241 AKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI 300 AK+V AY THP+ SG A + NS +DE+VV DTIPLS + P VR LT + +LAE Sbjct: 242 AKKVVAYCTHPVLSGPAIERIANSPLDELVVTDTIPLSPAARGCPKVRQLTCADLLAETF 301 Query: 301 RRISNEESISAMF 313 +RI+ +S+ ++F Sbjct: 302 KRITKGDSVMSLF 314 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 316 Length adjustment: 27 Effective length of query: 288 Effective length of database: 289 Effective search space: 83232 Effective search space used: 83232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS19570 HSERO_RS19570 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.26457.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-126 407.2 0.1 2e-126 407.1 0.1 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS19570 HSERO_RS19570 ribose-phosphate p Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS19570 HSERO_RS19570 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 407.1 0.1 2e-126 2e-126 2 308 .. 7 314 .. 6 315 .. 0.98 Alignments for each domain: == domain 1 score: 407.1 bits; conditional E-value: 2e-126 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmell 69 +++ g++++ela+ va++lg++lg+++v kF+dgE++v+i+e+vrgkdvf++ qst+ap+nd+lme++ lcl|FitnessBrowser__HerbieS:HSERO_RS19570 7 MVFTGNANPELARGVAEKLGIPLGKANVSKFSDGEVMVEINENVRGKDVFVL-QSTCAPTNDNLMEIM 73 89**************************************************.*************** PP TIGR01251 70 llidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfF 136 +++dalkrasa+++ta iPyygYaRqd++ + r +isak+va++l+eaG++rvl++dlH++qiqgfF lcl|FitnessBrowser__HerbieS:HSERO_RS19570 74 IMVDALKRASAGRITAAIPYYGYARQDRRPRsARVAISAKVVANMLQEAGVERVLIMDLHADQIQGFF 141 ****************************97758*********************************** PP TIGR01251 137 dvpvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnl 204 d+pv+n++asp l+ +l +k+ ++l+vvsPD G+v ra+++ak+l+++laii+K+R+ k+n+ ev+n+ lcl|FitnessBrowser__HerbieS:HSERO_RS19570 142 DIPVDNIYASPILLGDLVNKNYEDLLVVSPDVGGVVRARALAKRLNCDLAIIDKRRP-KANVSEVMNI 208 *********************************************************.899******* PP TIGR01251 205 lgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtnti 272 +g+veg+++vi+DD+++T+gTl+kaae+Lke+GAkkv++++th+v+sg+A+er+a++ ++e++vt+ti lcl|FitnessBrowser__HerbieS:HSERO_RS19570 209 IGEVEGRNCVIMDDMVDTAGTLTKAAEVLKERGAKKVVAYCTHPVLSGPAIERIANSPLDELVVTDTI 276 ******************************************************************** PP TIGR01251 273 lv.ee.kklpkvseisvapliaeaiarihenesvsslf 308 + + +pkv++++ a+l+ae+ +ri+++ sv slf lcl|FitnessBrowser__HerbieS:HSERO_RS19570 277 PLsPAaRGCPKVRQLTCADLLAETFKRITKGDSVMSLF 314 **644699*****************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory