Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (characterized)
to candidate HSERO_RS05420 HSERO_RS05420 4-aminobutyrate aminotransferase
Query= SwissProt::P18335 (406 letters) >FitnessBrowser__HerbieS:HSERO_RS05420 Length = 426 Score = 233 bits (594), Expect = 8e-66 Identities = 138/404 (34%), Positives = 213/404 (52%), Gaps = 35/404 (8%) Query: 25 EFIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHISNVFTN- 83 +F + + +WD +G+ ++DFA GIAV GH HP L++A++ Q + H + Sbjct: 27 DFYAERAANAELWDVEGRRFIDFAAGIAVLNTGHRHPKLLDAMRAQMDKFTHTAYQIVPY 86 Query: 84 ----EPALRLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHN 139 E A R+ R L + ++ F ++G EA E A K+AR + + +IAF Sbjct: 87 ASYVELAERINR-LTPGNYPKKTAFFSTGAEAVENAIKIARAHTG------RPGVIAFAG 139 Query: 140 AFHGRSLFTVSVGGQ-PKYSDGFGPKPADIIHVPF----------NDLHAVKAVMDD--- 185 FHGR++ +++ G+ Y GFGP P D+ H P+ + L AVK + Sbjct: 140 GFHGRTMMGMALTGKVAPYKLGFGPFPGDVFHAPYPSALHGITSEDALEAVKGLFKSDIE 199 Query: 186 --HTCAVVVEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMH 243 A+++EP+QGEGG AA +F++GLR LCD+H LL+ DEVQ G GRTG LFA H Sbjct: 200 AKRVAAIILEPVQGEGGFYAAPADFMRGLRALCDEHGILLIADEVQSGYGRTGKLFAMEH 259 Query: 244 YGVTPDILTSAKALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIIN 303 Y V PD++T AK+L GG P+SA+ AEI A PG G TY GNPLA A A A D++ Sbjct: 260 YDVLPDLMTMAKSLAGGMPLSAVNGRAEIMDAPAPGGLGGTYAGNPLAIASALAVLDVME 319 Query: 304 TPEVLEGIQAKRQRFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGR-----ARDFL 358 +++ Q + +HL+++ +++RG+G ++ E G+ + Sbjct: 320 EEQLVTRGQRLGDKLQEHLKELRSSVPQIAEVRGVGAMVAVEFADPATGKPDAEYTKKVQ 379 Query: 359 YAGAEAGVMVLNAGP--DVMRFAPSLVVEDADIDEGMQRFAHAV 400 G+++L G +V+RF L + D +DE + A A+ Sbjct: 380 QHALNNGLLLLTCGSYGNVIRFLFPLTIPDTVMDEALGILAKAI 423 Lambda K H 0.322 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 426 Length adjustment: 31 Effective length of query: 375 Effective length of database: 395 Effective search space: 148125 Effective search space used: 148125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory