Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate HSERO_RS10805 HSERO_RS10805 succinyldiaminopimelate aminotransferase
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__HerbieS:HSERO_RS10805 Length = 403 Score = 484 bits (1246), Expect = e-141 Identities = 248/400 (62%), Positives = 298/400 (74%), Gaps = 9/400 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 +NP LD L PYPFEKL+ L A P PI+L IGEPKH PA + QA+ NLAGL+ Sbjct: 1 VNPLLDQLQPYPFEKLKKLFAGI-TPDPAYRPISLGIGEPKHPTPAFIQQALIDNLAGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSA-GAL 119 YP+T G ALR AI+ WL +RY IP PDP +E+LPV GSREALF+ QTV+DP+ GAL Sbjct: 60 SYPATLGSDALRGAIADWLQKRYDIPRPDPATEILPVNGSREALFSLTQTVVDPTRPGAL 119 Query: 120 VVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPA 179 V+CPNPFYQIYEG+A LAGA PY+VN+DP R+F +VP +VW R QL+FVCSPGNP Sbjct: 120 VMCPNPFYQIYEGSAYLAGAQPYFVNSDPKRNFAPDFSQVPQDVWERVQLLFVCSPGNPT 179 Query: 180 GNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVA 239 G V++LE+W+ LF LSDR+GFVIA+ ECYSEIY +ED PPLG +QAAR LGRD Y L++ Sbjct: 180 GAVLTLEDWKELFALSDRYGFVIASDECYSEIYFNED-PPLGGMQAARLLGRD-YRRLIS 237 Query: 240 FSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRMCR-K 298 FSSLSKRSNVPGMRSGFVAGDAA+L +FLLYRTYHG+AMSPV+ AAS+ AW + Sbjct: 238 FSSLSKRSNVPGMRSGFVAGDAAILKKFLLYRTYHGAAMSPVIQAASVLAWQDETHVQGN 297 Query: 299 TAQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPG----SDTAFARELYGRTGVTVLPG 354 A+Y KF V P+LQ VL+V P A+FYLWA SDT FA+ LY VTVLPG Sbjct: 298 IAKYVTKFSQVTPLLQEVLEVALPDAAFYLWAKVDKLVNISDTEFAQRLYAEYNVTVLPG 357 Query: 355 SLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFAR 394 S LAREAH NPG GRIR+ALVA +++C++AA+RI F R Sbjct: 358 SYLAREAHGVNPGAGRIRMALVAEVEECLEAAQRIVAFTR 397 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 403 Length adjustment: 31 Effective length of query: 366 Effective length of database: 372 Effective search space: 136152 Effective search space used: 136152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS10805 HSERO_RS10805 (succinyldiaminopimelate aminotransferase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.19371.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-187 607.6 0.0 5.2e-187 607.5 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS10805 HSERO_RS10805 succinyldiaminopim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS10805 HSERO_RS10805 succinyldiaminopimelate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 607.5 0.0 5.2e-187 5.2e-187 1 394 [. 1 395 [. 1 396 [. 0.98 Alignments for each domain: == domain 1 score: 607.5 bits; conditional E-value: 5.2e-187 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlp 68 +np l++l+pyPfekl++l++++tp +++i+l iGePkh+tPaf+++al++nl +l++yP+t G++ lcl|FitnessBrowser__HerbieS:HSERO_RS10805 1 VNPLLDQLQPYPFEKLKKLFAGITPDPAYRPISLGIGEPKHPTPAFIQQALIDNLAGLASYPATLGSD 68 599***************************************************************** PP TIGR03538 69 elreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.kalvvlPnPfyqiyeGaal 135 +lr aia+Wl++r+++p+ dp++++lPvnG+realf+++q+v+d+++ alv++PnPfyqiyeG+a+ lcl|FitnessBrowser__HerbieS:HSERO_RS10805 69 ALRGAIADWLQKRYDIPR-PDPATEILPVNGSREALFSLTQTVVDPTRpGALVMCPNPFYQIYEGSAY 135 ******************.9***************************9779999************** PP TIGR03538 136 lagaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiia 203 laga+pyf+n++++ +f pdf+ vp++vW+rvqllfvcsPgnPtGavl+le++k+l++l+d+y+f+ia lcl|FitnessBrowser__HerbieS:HSERO_RS10805 136 LAGAQPYFVNSDPKRNFAPDFSQVPQDVWERVQLLFVCSPGNPTGAVLTLEDWKELFALSDRYGFVIA 203 ******************************************************************** PP TIGR03538 204 sdecyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryr 271 sdecyse+y++e+ +P+G ++aa lGr d++rl+ f+slskrsnvPG+rsGfvaGda++lk+fl yr lcl|FitnessBrowser__HerbieS:HSERO_RS10805 204 SDECYSEIYFNED-PPLGGMQAARLLGR-DYRRLISFSSLSKRSNVPGMRSGFVAGDAAILKKFLLYR 269 **********665.*************8.9************************************** PP TIGR03538 272 tyhGcampiavqlasiaaWedekhvrenralyrekfaavleilgavldlelPdasfylWlkv...pdg 336 tyhG+am++ +q+as+ aW+de+hv+ n a+y kf++v+ +l++vl++ lPda+fylW+kv +++ lcl|FitnessBrowser__HerbieS:HSERO_RS10805 270 TYHGAAMSPVIQAASVLAWQDETHVQGNIAKYVTKFSQVTPLLQEVLEVALPDAAFYLWAKVdklVNI 337 *************************************************************9777789 PP TIGR03538 337 ddeafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaeleecveaaerikkl 394 d++fa++ly+e nv+vlpG+yl+rea+gvnPG+gr+r+alvae+eec eaa+ri ++ lcl|FitnessBrowser__HerbieS:HSERO_RS10805 338 SDTEFAQRLYAEYNVTVLPGSYLAREAHGVNPGAGRIRMALVAEVEECLEAAQRIVAF 395 *******************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (403 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory