Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized)
to candidate HSERO_RS16100 HSERO_RS16100 acetylornithine deacetylase
Query= curated2:B2IDW3 (383 letters) >FitnessBrowser__HerbieS:HSERO_RS16100 Length = 400 Score = 90.9 bits (224), Expect = 6e-23 Identities = 93/273 (34%), Positives = 125/273 (45%), Gaps = 30/273 (10%) Query: 6 LDLARALISCPSVTPQDGGTLGVLE---SRLKASGFRTHRLTFHEEGTPDIDNLYARFGS 62 LD+ LI +V+ + LG++E L+ G T RLT+ E NL+A G Sbjct: 17 LDILTTLIGFNTVSRESN--LGLIEWVRDHLERHGAVT-RLTYDAERRKA--NLFATLGD 71 Query: 63 GAPC---LVFAGHTDVVPVGTATDWRFDPFAAKVEDGQLWGRGAADMKGAIAAFTA--AA 117 P VF+GHTDVVPV T W DPF A V DG+L+GRGA DMKG IA A A Sbjct: 72 AGPGRFGTVFSGHTDVVPV-TGQKWDTDPFVAHVADGKLFGRGACDMKGFIAICMARLPA 130 Query: 118 LTFIEQHKDFKGSIAFLITGDEEGPSINGTIKLLKWAAEQGEHFDHCIVGEPTNPQVLGD 177 + H S ++ DEE + G +LL + I+GEPT Q + Sbjct: 131 IDLARLHTPLHFSFSY----DEEVGCL-GVRELLADLQQNDIRPTGVIIGEPTMMQPV-- 183 Query: 178 MIKIGRRGSLNGILSITGKQGHVAYPHRADNPV--PKLMRLIEALIGTPLDEG---TDHF 232 I +G + S+ G H + PH N + +M+L I + D F Sbjct: 184 ---IAHKGKRSYRCSVHGHAAHSSCPHLGINSIDFAAMMQLKIREIALRVRHSGVQDDDF 240 Query: 233 DASNLEV-VALSSGTDAYNVIPAKAEARFNIRF 264 D + L+SG +A N+IP KAE F RF Sbjct: 241 DVPYSSIATTLTSGGNAPNIIPDKAEFVFEHRF 273 Lambda K H 0.319 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 400 Length adjustment: 31 Effective length of query: 352 Effective length of database: 369 Effective search space: 129888 Effective search space used: 129888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory