Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate HSERO_RS20985 HSERO_RS20985 serine acetyltransferase
Query= curated2:Q5HPE5 (240 letters) >FitnessBrowser__HerbieS:HSERO_RS20985 Length = 188 Score = 58.5 bits (140), Expect = 9e-14 Identities = 44/144 (30%), Positives = 62/144 (43%), Gaps = 19/144 (13%) Query: 93 ARIEPGAFIREQAIIEDGAVVMMGATINIGAIVGEGTMIDMNATLGGRATTGKNVHV--- 149 A ++ GA I E I A + GA I G+ + + +G NV + Sbjct: 9 ALVDEGAQIGEATRIWHWAHICSGARIGERCSFGQNVFVGNDVLIGNNVKVQNNVSIYDA 68 Query: 150 ---------GAGAVLAGVIEPPSASP-------VVIEDNVLIGANAVILEGVRVGAGAIV 193 G V V P SA ++ IGANA I+ G +G A + Sbjct: 69 VTLEDDVFCGPSMVFTNVNNPRSAVSRKHEYRRTLVRRGASIGANATIVCGHEIGEYAFI 128 Query: 194 AAGAIVTQDVPAGAVVAGTPAKVI 217 AGA+VT+DVPA A++ GTPA+ I Sbjct: 129 GAGAVVTRDVPAYALMVGTPARRI 152 Lambda K H 0.315 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 83 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 188 Length adjustment: 21 Effective length of query: 219 Effective length of database: 167 Effective search space: 36573 Effective search space used: 36573 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory