Align DUF1852 domain-containing protein (characterized, see rationale)
to candidate HSERO_RS02800 HSERO_RS02800 hypothetical protein
Query= uniprot:Q6F6Z7 (355 letters) >FitnessBrowser__HerbieS:HSERO_RS02800 Length = 327 Score = 499 bits (1286), Expect = e-146 Identities = 240/325 (73%), Positives = 277/325 (85%), Gaps = 2/325 (0%) Query: 15 MSQTFEFSIKSIRFDEDYRPSDNTRITTNFANLARGESRQENLRNTLNMINNRFNALADW 74 M + F+IK I FDEDYRP+DNTRITTNFANLARG RQENLRNT MINNRFNALA W Sbjct: 1 MDKDLSFAIKRICFDEDYRPADNTRITTNFANLARGAQRQENLRNTFRMINNRFNALAHW 60 Query: 75 DNPNGDRYAVELDIISVDIDVEG--NGETFPTIEILKTNIIDYKNNQRIEGIVGNNFSSY 132 DNP GDRYAVELDIISV++ G + + P IE+LKT+I+D+K +RIEGIVGNNFSSY Sbjct: 61 DNPKGDRYAVELDIISVEMGFAGEDHAQALPLIEVLKTSIVDHKTGERIEGIVGNNFSSY 120 Query: 133 VRDYDFSVLLLEHNKNQAKFSTPENYGELHGKIFKSFVNSNTFNDNFSKQPVICLSVSTT 192 VRDYDFSV+LLEH + Q FS PE++GELHGK+FK FV S + +FSK PVICLSV+++ Sbjct: 121 VRDYDFSVVLLEHTRGQPDFSVPEHFGELHGKLFKRFVQSQAYQAHFSKPPVICLSVASS 180 Query: 193 KTYHRTTNQHPVLGVEYQQDAYSLTDEYFAKMGLKVRYFMPKNSVAPLAFYFRGDLLSDY 252 KTYHRT N HPVLGVEY QD YSLTD YF KMGLKVRYFMP +S APLAFYF GDLLSDY Sbjct: 181 KTYHRTENLHPVLGVEYLQDEYSLTDAYFGKMGLKVRYFMPPDSAAPLAFYFSGDLLSDY 240 Query: 253 TDLELIGTISTMETFQKIYRPEIYNANSVAGQIYQPSLKHQDFSLTRIVYDREERSQLAI 312 T+LELI TISTMETFQKIYRPEIYNANS AG+ YQPSLKHQD+SLTRIVYDREERS+LAI Sbjct: 241 TNLELISTISTMETFQKIYRPEIYNANSAAGKTYQPSLKHQDYSLTRIVYDREERSRLAI 300 Query: 313 KQGKWTEEHFMKPYQSILERWAANY 337 +QG++ EEHF+KPYQ++L++W+A+Y Sbjct: 301 EQGRFAEEHFIKPYQALLDQWSASY 325 Lambda K H 0.317 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 327 Length adjustment: 28 Effective length of query: 327 Effective length of database: 299 Effective search space: 97773 Effective search space used: 97773 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory